KEGG   Homo sapiens (human): 4921Help
Entry
4921              CDS       T01001                                 

Gene name
DDR2, MIG20a, NTRKR3, TKT, TYRO10, WRCN
Definition
(RefSeq) discoidin domain receptor tyrosine kinase 2
  KO
K05125  discoidin domain receptor family member 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Disease
H00777  SEMD, short limb-hand type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4921 (DDR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4921 (DDR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4921 (DDR2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  DDR family
   4921 (DDR2)
CD molecules [BR:hsa04090]
 Proteins
  4921 (DDR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F5_F8_type_C Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 4921
NCBI-ProteinID: NP_001014796
OMIM: 191311
HGNC: 2731
Ensembl: ENSG00000162733
Vega: OTTHUMG00000034423
Pharos: Q16832(Tchem)
UniProt: Q16832 A0A024R906
Structure
PDB: 

Position
1q23.3
AA seq 855 aa AA seqDB search
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgattcccagaatgctcttggtgctgttcctgctgctgcctatcttgagttct
gcaaaagctcaggttaatccagctatatgccgctatcctctgggcatgtcaggaggccag
attccagatgaggacatcacagcttccagtcagtggtcagagtccacagctgccaaatat
ggaaggctggactcagaagaaggggatggagcctggtgccctgagattccagtggaacct
gatgacctgaaggagtttctgcagattgacttgcacaccctccattttatcactctggtg
gggacccaggggcgccatgcaggaggtcatggcatcgagtttgcccccatgtacaagatc
aattacagtcgggatggcactcgctggatctcttggcggaaccgtcatgggaaacaggtg
ctggatggaaatagtaacccctatgacattttcctaaaggacttggagccgcccattgta
gccagatttgtccggttcattccagtcaccgaccactccatgaatgtgtgtatgagagtg
gagctttacggctgtgtctggctagatggcttggtgtcttacaatgctccagctgggcag
cagtttgtactccctggaggttccatcatttatctgaatgattctgtctatgatggagct
gttggatacagcatgacagaagggctaggccaattgaccgatggtgtgtctggcctggac
gatttcacccagacccatgaataccacgtgtggcccggctatgactatgtgggctggcgg
aacgagagtgccaccaatggctacattgagatcatgtttgaatttgaccgcatcaggaat
ttcactaccatgaaggtccactgcaacaacatgtttgctaaaggtgtgaagatctttaag
gaggtacagtgctacttccgctctgaagccagtgagtgggaacctaatgccatttccttc
ccccttgtcctggatgacgtcaaccccagtgctcggtttgtcacggtgcctctccaccac
cgaatggccagtgccatcaagtgtcaataccattttgcagatacctggatgatgttcagt
gagatcaccttccaatcagatgctgcaatgtacaacaactctgaagccctgcccacctct
cctatggcacccacaacctatgatccaatgcttaaagttgatgacagcaacactcggatc
ctgattggctgcttggtggccatcatctttatcctcctggccatcattgtcatcatcctc
tggaggcagttctggcagaaaatgctggagaaggcttctcggaggatgctggatgatgaa
atgacagtcagcctttccctgccaagtgattctagcatgttcaacaataaccgctcctca
tcacctagtgaacaagggtccaactcgacttacgatcgcatctttccccttcgccctgac
taccaggagccatccaggctgatacgaaaactcccagaatttgctccaggggaggaggag
tcaggctgcagcggtgttgtgaagccagtccagcccagtggccctgagggggtgccccac
tatgcagaggctgacatagtgaacctccaaggagtgacaggaggcaacacatactcagtg
cctgccgtcaccatggacctgctctcaggaaaagatgtggctgtggaggagttccccagg
aaactcctaactttcaaagagaagctgggagaaggacagtttggggaggttcatctctgt
gaagtggagggaatggaaaaattcaaagacaaagattttgccctagatgtcagtgccaac
cagcctgtcctggtggctgtgaaaatgctccgagcagatgccaacaagaatgccaggaat
gattttcttaaggagataaagatcatgtctcggctcaaggacccaaacatcatccatcta
ttagctgtgtgtatcactgatgaccctctctgtatgatcactgaatacatggagaatgga
gatctcaatcagtttctttcccgccacgagccccctaattcttcctccagcgatgtacgc
actgtcagttacaccaatctgaagtttatggctacccaaattgcctctggcatgaagtac
ctttcctctcttaattttgttcaccgagatctggccacacgaaactgtttagtgggtaag
aactacacaatcaagatagctgactttggaatgagcaggaacctgtacagtggtgactat
taccggatccagggccgggcagtgctccctatccgctggatgtcttgggagagtatcttg
ctgggcaagttcactacagcaagtgatgtgtgggcctttggggttactttgtgggagact
ttcaccttttgtcaagaacagccctattcccagctgtcagatgaacaggttattgagaat
actggagagttcttccgagaccaagggaggcagacttacctccctcaaccagccatttgt
cctgactctgtgtataagctgatgctcagctgctggagaagagatacgaagaaccgtccc
tcattccaagaaatccaccttctgctccttcaacaaggcgacgagtga

DBGET integrated database retrieval system