KEGG   Homo sapiens (human): 4922Help
Entry
4922              CDS       T01001                                 

Gene name
NTS, NMN-125, NN, NT, NT/N, NTS1
Definition
(RefSeq) neurotensin
  KO
K05235  neurotensin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4922 (NTS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro-NT_NN RNase_J_C
Motif
Other DBs
NCBI-GeneID: 4922
NCBI-ProteinID: NP_006174
OMIM: 162650
HGNC: 8038
Ensembl: ENSG00000133636
Vega: OTTHUMG00000169832
Pharos: P30990(Tbio)
CPD: C01836 C15868
UniProt: P30990 Q6FH20
Position
12q21.31
AA seq 170 aa AA seqDB search
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLN
VCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWE
LIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaggaatgaaaatccagcttgtatgcatgctactcctggctttcagctcctgg
agtctgtgctcagattcagaagaggaaatgaaagcattagaagcagatttcttgaccaat
atgcatacatcaaagattagtaaagcacatgttccctcttggaagatgactctgctaaat
gtttgcagtcttgtaaataatttgaacagcccagctgaggaaacaggagaagttcatgaa
gaggagcttgttgcaagaaggaaacttcctactgctttagatggctttagcttggaagca
atgttgacaatataccagctccacaaaatctgtcacagcagggcttttcaacactgggag
ttaatccaggaagatattcttgatactggaaatgacaaaaatggaaaggaagaagtcata
aagagaaaaattccttatattctgaaacggcagctgtatgagaataaacccagaagaccc
tacatactcaaaagagattcttactattactga

DBGET integrated database retrieval system