KEGG   Homo sapiens (human): 4924
Entry
4924              CDS       T01001                                 

Symbol
NUCB1, CALNUC, NUC
Name
(RefSeq) nucleobindin 1
  KO
K20371  nucleobindin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4924 (NUCB1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    4924 (NUCB1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    4924 (NUCB1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   4924 (NUCB1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5
Other DBs
NCBI-GeneID: 4924
NCBI-ProteinID: NP_006175
OMIM: 601323
HGNC: 8043
Ensembl: ENSG00000104805
Vega: OTTHUMG00000152514
Pharos: Q02818(Tbio)
UniProt: Q02818 A8K7Q1
Structure
PDB: 
1SNL

Position
19q13.33
AA seq 461 aa
MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVID
VLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMD
AEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYE
MLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDP
NRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHV
MKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRFEEELAAREAE
LNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgcctccctctgggccccgaggaaccctccttctgttgccgctgctgctgctgctcctg
cttcgcgccgtgctggctgtccccctggagcgaggggcgcccaacaaggaggagacccct
gcgactgagagtcccgacacaggcctgtactaccaccggtacctccaggaggtcatcgat
gtactggagacggatgggcatttccgagagaagctgcaggctgccaatgcggaggacatc
aagagcgggaagctgagccgagagctggactttgtcagccaccacgtccgcaccaagctg
gatgagctcaagcgacaggaggtgtcacggctgcggatgctgctcaaggccaagatggac
gccgagcaggatcccaatgtacaggtggatcatctgaatctcctgaaacagtttgaacac
ctggaccctcagaaccagcatacattcgaggcccgcgacctggagctgctgatccagacg
gccacccgggaccttgcccagtacgacgcagcccatcatgaagagttcaagcgctacgag
atgcttaaggaacacgagagacggcgttatctggagtcactgggagaggagcagagaaag
gaggcggagaggaagctggaagagcaacagcgccggcaccgcgagcaccctaaagtcaac
gtgcctggcagccaagcccagttgaaggaggtgtgggaggagctggatggactggacccc
aacaggtttaaccccaagaccttcttcatactgcatgatatcaacagtgatggtgtcctg
gatgagcaggagctggaggcactcttcaccaaggagctggagaaagtgtacgacccaaag
aatgaggaggacgacatgcgggagatggaggaggagcgactgcgcatgcgggagcatgtg
atgaagaatgtggacaccaaccaggaccgcctcgtgaccctggaggagttcctcgcatcc
actcagaggaaggagtttggggacaccggggagggctgggagacagtggagatgcaccct
gcctacaccgaggaagagctgaggcgctttgaagaggagctggctgcccgggaggcagag
ctgaatgccaaggcccagcgcctcagccaggagacagaggctctagggcggtcccagggc
cgcctggaggcccagaagagagagctgcagcaggctgtgctgcacatggagcagcggaag
cagcagcagcagcagcagcaaggccacaaggccccggctgcccaccctgaggggcagctc
aagttccacccagacacagacgatgtacctgtcccagctccagccggtgaccagaaggag
gtggacacttcagaaaagaaacttctcgagcggctccctgaggttgaggtgccccagcat
ctgtga

DBGET integrated database retrieval system