KEGG   Homo sapiens (human): 4929Help
Entry
4929              CDS       T01001                                 

Gene name
NR4A2, HZF-3, NOT, NURR1, RNR1, TINUR
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 2
  KO
K08558  nuclear receptor subfamily 4 group A member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04925  Aldosterone synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H00057  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4929 (NR4A2)
   04925 Aldosterone synthesis and secretion
    4929 (NR4A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4929 (NR4A2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    4929 (NR4A2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 nerve growth factor IB-like
    4929 (NR4A2)
Nuclear receptors [BR:hsa03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   4929 (NR4A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 4929
NCBI-ProteinID: NP_006177
OMIM: 601828
HGNC: 7981
Ensembl: ENSG00000153234
Vega: OTTHUMG00000131950
Pharos: P43354(Tchem)
UniProt: P43354 F1D8N6 Q53EL4
Structure
PDB: 

Position
2q24.1
AA seq 598 aa AA seqDB search
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgttcaggcgcagtatgggtcctcgcctcaaggagccagccccgcttctcag
agctacagttaccactcttcgggagaatacagctccgatttcttaactccagagtttgtc
aagtttagcatggacctcaccaacactgaaatcactgccaccacttctctccccagcttc
agtacctttatggacaactacagcacaggctacgacgtcaagccaccttgcttgtaccaa
atgcccctgtccggacagcagtcctccattaaggtagaagacattcagatgcacaactac
cagcaacacagccacctgcccccccagtctgaggagatgatgccgcactccgggtcggtt
tactacaagccctcctcgcccccgacgcccaccaccccgggcttccaggtgcagcacagc
cccatgtgggacgacccgggatctctccacaacttccaccagaactacgtggccactacg
cacatgatcgagcagaggaaaacgccagtctcccgcctctccctcttctcctttaagcaa
tcgccccctggcaccccggtgtctagttgccagatgcgcttcgacgggcccctgcacgtc
cccatgaacccggagcccgccggcagccaccacgtggtggacgggcagaccttcgctgtg
cccaaccccattcgcaagcccgcgtccatgggcttcccgggcctgcagatcggccacgcg
tctcagctgctcgacacgcaggtgccctcaccgccgtcgcggggctccccctccaacgag
gggctgtgcgctgtgtgtggggacaacgcggcctgccaacactacggcgtgcgcacctgt
gagggctgcaaaggcttctttaagcgcacagtgcaaaaaaatgcaaaatacgtgtgttta
gcaaataaaaactgcccagtggacaagcgtcgccggaatcgctgtcagtactgccgattt
cagaagtgcctggctgttgggatggtcaaagaagtggttcgcacagacagtttaaaaggc
cggagaggtcgtttgccctcgaaaccgaagagcccacaggagccctctcccccttcgccc
ccggtgagtctgatcagtgccctcgtcagggcccatgtcgactccaacccggctatgacc
agcctggactattccaggttccaggcgaaccctgactatcaaatgagtggagatgacacc
cagcatatccagcaattctatgatctcctgactggctccatggagatcatccggggctgg
gcagagaagatccctggcttcgcagacctgcccaaagccgaccaagacctgctttttgaa
tcagctttcttagaactgtttgtccttcgattagcatacaggtccaacccagtggagggt
aaactcatcttttgcaatggggtggtcttgcacaggttgcaatgcgttcgtggctttggg
gaatggattgattccattgttgaattctcctccaacttgcagaatatgaacatcgacatt
tctgccttctcctgcattgctgccctggctatggtcacagagagacacgggctcaaggaa
cccaagagagtggaagaactgcaaaacaagattgtaaattgtctcaaagaccacgtgact
ttcaacaatggggggttgaaccgccccaattatttgtccaaactgttggggaagctccca
gaacttcgtaccctttgcacacaggggctacagcgcattttctacctgaaattggaagac
ttggtgccaccgccagcaataattgacaaacttttcctggacactttacctttctaa

DBGET integrated database retrieval system