KEGG   Homo sapiens (human): 4931Help
Entry
4931              CDS       T01001                                 

Gene name
NVL, NVL2
Definition
(RefSeq) nuclear VCP-like
  KO
K14571  ribosome biogenesis ATPase
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    4931 (NVL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    4931 (NVL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Nucleolin_bd RuvB_N AAA_16 AAA_2 AAA_22 AAA_5 AAA_33 TIP49 AAA_14 Mg_chelatase AAA_18 RNA_helicase Zeta_toxin IstB_IS21 AAA_28 NACHT TsaE ATPase ABC_tran AAA_3 Viral_helicase1 Sigma54_activat Vps4_C AAA_17 Cytidylate_kin2 DUF815 Rad17
Motif
Other DBs
NCBI-GeneID: 4931
NCBI-ProteinID: NP_002524
OMIM: 602426
HGNC: 8070
Ensembl: ENSG00000143748
Vega: OTTHUMG00000037536
Pharos: O15381(Tbio)
UniProt: O15381 B4DF43
Structure
PDB: 

Position
1q42.11
AA seq 856 aa AA seqDB search
MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVE
KVFSIISSEKELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMN
SSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPS
VKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVDG
EIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRG
VLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCI
IFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPAL
RRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCRE
AAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP
LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAP
VRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESE
RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFI
MAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIA
GDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSIS
KKDQIMYERLQESLSR
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagacctgcagggttcgtggataataaactcaagcagcgagtcatccagtac
cttaccagtaacaaatgtggcaaatatgtggacattggagtcttagcgtctgatttacaa
agagtgtacagtatagactatggtcgaagaaaaagaaatgcttttaggattcaggtagaa
aaagtatttagcataattagtagtgagaaggaacttaagaatttaacagaattagaagat
gaacatttggcaaaaagggcaagacaaggtgaagaggataatgagtatactgaaagctat
tctgatgatgattcaagtatggaagactacccagatccacagtcagcaaatcacatgaac
agttccctgctgtctttatatcggaaaggaaatcctgattctgtttcaaatactcctgag
atggagcaaagagaaaccacctcttcaacaccacggataagttccaaaacaggctccatt
cccttgaagacccctgccaaagattctgaaggaggatggtttattgacaaaaccccaagt
gtaaagaaagacagttttttcttggacctgtcatgtgagaaaagtaatcctaagaagcca
ataactgagatacaggattcaaaagattcttctcttttggagagtgatatgaaacggaaa
ggcaagctaaagaataaaggaagcaaaaggaagaaagaagatcttcaggaagtagatgga
gaaattgaagctgtcctgcaaaagaaagctaaagccagggggttagaattccagatctcc
aacgtgaagtttgaagatgtgggaggcaatgatatgacattaaaagaggtctgcaagatg
ctcatacacatgcgtcacccggaggtgtaccaccacctgggcgtcgtgccccctcgtgga
gttctccttcatggaccaccaggctgtgggaagacattacttgcacatgcaattgctggg
gaacttgacctgccaattttgaaagtggctgctccagagattgtgtctggagtatccgga
gagtctgagcagaagctgagagaactatttgagcaagctgtgtcaaatgcaccatgtatc
attttcattgatgaaattgatgctattacccccaaaagagaagtggcttcaaaagatatg
gaacgaagaattgtagcccaactcctaacctgcatggatgatctgaataatgtggctgct
acagcccgggtcctagttattggagctactaatcgaccagactcgttagaccctgctttg
agacgtgcgggaaggttcgaccgagaaatatgcctaggtatcccagatgaagcatccagg
gaaagaatacttcaaacattgtgcagaaaactgaggcttcctcaagcttttgatttctgt
cacttagcacacctaactccaggctttgttggtgctgatctcatggcactgtgccgagag
gcagcaatgtgtgcagtcaatagagtcttaatgaagctacaggaacagcagaagaaaaat
cctgaaatggaagatttgccatctaaaggagtccaggaggaaaggctgggaactgagccc
acttctgaaacacaggatgaattacaaaggctgctggggttgctaagagaccaagatccc
ctctcagaggagcagatgcaaggactgtgcattgaactgaatgatttcattgttgctcta
tcctcagtccaaccctctgccaaaagggaaggctttgtcactgtccctaatgtgacatgg
gcagatattggtgccctggaagacattagagaggagctcaccatggcaatattggcacca
gtacgcaacccagaccagttcaaagctcttggattggtgactccagctggggtcctcctt
gctggtcctcctggctgtgggaagactctgctggcgaaggctgttgcaaatgagtccgga
ctaaattttatatctgtcaagggccccgaattactaaacatgtatgttggtgagagtgaa
cgtgctgtgcgacaagtttttcaacgagccaagaactcagcaccctgtgtgatattcttt
gatgaagtggatgctttatgtcctcgaagatcagaccgagagacaggggcaagtgtccga
gtggtgaatcagctacttacagagatggatggtctggaagcacgccagcaggtttttatt
atggcagccactaacaggccagatataattgaccctgcaatcctgcgcccgggccgcctg
gacaaaacactgtttgtgggtttaccgccccctgcagatcgccttgccatcttaaaaact
atcacaaaaaatggtaccaaaccaccactggatgcagatgtaaatttggaagcaattgct
ggtgaccttcgctgtgattgctatacgggcgcagatctctctgctttggtacgagaagct
tctatctgtgccctgagacaggaaatggcaagacagaagagtggaaatgaaaaaggtgaa
ctcaaggttagtcataagcattttgaagaagctttcaagaaagtaagatcatctatatca
aaaaaggatcaaatcatgtatgaacgtttgcaggagtccctcagccggtga

DBGET integrated database retrieval system