KEGG   Homo sapiens (human): 4938Help
Entry
4938              CDS       T01001                                 

Gene name
OAS1, E18/E16, IFI-4, OIAS, OIASI
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 1
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
Network
N00273  HCV NS5A to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4938 (OAS1)
 09160 Human Diseases
  09167 Infectious diseases
   05162 Measles
    4938 (OAS1)
   05164 Influenza A
    4938 (OAS1)
   05160 Hepatitis C
    4938 (OAS1)
   05168 Herpes simplex infection
    4938 (OAS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4938 (OAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 4938
NCBI-ProteinID: NP_058132
OMIM: 164350
HGNC: 8086
Ensembl: ENSG00000089127
Vega: OTTHUMG00000169792
Pharos: P00973(Tbio)
UniProt: P00973
Structure
PDB: 

Position
12q24.13
AA seq 400 aa AA seqDB search
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctcagaaataccccagccaaatctctggacaagttcattgaagactatctc
ttgccagacacgtgtttccgcatgcaaatcaaccatgccattgacatcatctgtgggttc
ctgaaggaaaggtgcttccgaggtagctcctaccctgtgtgtgtgtccaaggtggtaaag
ggtggctcctcaggcaagggcaccaccctcagaggccgatctgacgctgacctggttgtc
ttcctcagtcctctcaccacttttcaggatcagttaaatcgccggggagagttcatccag
gaaattaggagacagctggaagcctgtcaaagagagagagcattttccgtgaagtttgag
gtccaggctccacgctggggcaacccccgtgcgctcagcttcgtactgagttcgctccag
ctcggggagggggtggagttcgatgtgctgcctgcctttgatgccctgggtcagttgact
ggcggctataaacctaacccccaaatctatgtcaagctcatcgaggagtgcaccgacctg
cagaaagagggcgagttctccacctgcttcacagaactacagagagacttcctgaagcag
cgccccaccaagctcaagagcctcatccgcctagtcaagcactggtaccaaaattgtaag
aagaagcttgggaagctgccacctcagtatgccctggagctcctgacggtctatgcttgg
gagcgagggagcatgaaaacacatttcaacacagcccagggatttcggacggtcttggaa
ttagtcataaactaccagcaactctgcatctactggacaaagtattatgactttaaaaac
cccattattgaaaagtacctgagaaggcagctcacgaaacccaggcctgtgatcctggac
ccggcggaccctacaggaaacttgggtggtggagacccaaagggttggaggcagctggca
caagaggctgaggcctggctgaattacccatgctttaagaattgggatgggtccccagtg
agctcctggattctgctggctgaaagcaacagtgcagacgatgagaccgacgatcccagg
aggtatcagaaatatggttacattggaacacatgagtaccctcatttctctcatagaccc
agcacactccaggcagcatccaccccacaggcagaagaggactggacctgcaccatcctc
tga

DBGET integrated database retrieval system