KEGG   Homo sapiens (human): 493860
Entry
493860            CDS       T01001                                 

Gene name
CCDC73, NY-SAR-79
Definition
(RefSeq) coiled-coil domain containing 73
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC73 DUF2846
Other DBs
NCBI-GeneID: 493860
NCBI-ProteinID: NP_001008392
OMIM: 612328
HGNC: 23261
Ensembl: ENSG00000186714
Vega: OTTHUMG00000166279
Pharos: Q6ZRK6(Tdark)
UniProt: Q6ZRK6
Position
11p13
AA seq 1079 aa
MESNFNTESSSTFTLQSSSETLFSIQLLDFKTSLLEALEELRMRREAEIHYEEQIGKIIV
ETQELKWQKETLQNQKETLAEQHKEAMAVFKKQLQMKMCALEEEKGKYQLATEIKEKEIE
GLKETLKALQVSKYSLQKKVSEMEQKVQLHLLAKEDYHKQLSEIEKYYATITGQFGLVKE
NHEKLEQNVREAIQSNKRLSALNKKQEAEICSLKKELKKAASDLIKSKVTCQYKMGEENI
NLTIKEQKFQELQERLNMELELNEKINEEITHIQEEKQDIIISFQHMQQLLRQQIQANTE
MEAELKVLKENNQTLERDNELQREKVKENEEKFLNLQNEHEKALGTWKRHAEELNGEINK
IKNELSSLKETHIKLQEHYNKLCNQKTFEEDKKFQNVPEVNNENSEMSTEKSENTIIQKY
NTEQEIREENMENFCSDTEYREKEEKKEGSFIEEIIIDDLQLFEKSFKNEIDTVVSQDEN
QSEISLSKTLSLDKEVISQGQTSNVTDNRKSVTTEIKDKICLEKDNGCTEFKSPNNHFVV
LDTAIETEKIHLERTRGLDVHHTDVNLEVENNKTSFNSILNETAHNTYHNNNKDVSENEP
FKQFRLLPGTREHALEKEITNSDQTKADLDSSLDIKKNPVPCQKYSLRNSSNVMLDDKQC
KIKQIQLLTKKSECSILLSKQTSDFLQVCNDTLEKSELTVPCDIVIDHHVSYAAFSANSK
LLLKNSDKNVHSMSMLVKPNSSPGGKTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLN
NENSHASQAKDVKTAVHMKTCTETEFSNKKNQIDENQVTEATKNDLFLFVSINERQHTLL
NNTEKTESLNDIVSGKMFSEGQLEESHSFHIEPSGDLVNRSGRSTFDLSTSDKKTEKTPV
YMNFSDPGPWSKVNHIESQTASSSTPCISLLLKERPLDPSENKKIISMALCKNIGVDDVG
KDIGPDTTSINRVADTLNNWSIHPDPKGEPSEEKNAMAKTFYDSSFPTEHVKTKPLISTP
LQSHLQAIKTTKNTSGDDDWQSLITNQLNKSENLLSLENDNQPKKRKAEETLEKNNRLK
NT seq 3240 nt   +upstreamnt  +downstreamnt
atggaaagcaacttcaatactgagtcatcatctacttttactcttcaaagttcttcagag
acattgttttctattcagctattagatttcaaaacaagtttactggaggcattagaagaa
ttgcgtatgagaagggaagcagaaattcattatgaagagcagattggtaaaattattgtg
gagacacaggaacttaaatggcaaaaggaaactcttcagaatcaaaaggaaacattggca
gagcaacacaaggaagcaatggcagtttttaaaaagcagttgcagatgaagatgtgtgcc
ctggaagaagaaaagggaaaatatcaacttgctacagaaataaaggaaaaagaaatagaa
ggattgaaggaaacattaaaagcactacaggtttctaaatactctttacagaagaaagtg
agtgaaatggaacaaaaggtccagttacatcttctggctaaagaagactatcataagcaa
ctgagtgaaattgagaaatattatgccacaataacaggtcaatttggattggtaaaagag
aatcatgaaaagttagaacaaaatgtacgggaagcaatacaatcaaacaaaagactttca
gctttaaataaaaaacaagaagctgaaatatgcagtttaaagaaggaactaaaaaaagca
gcctcagacttgataaagtccaaagtcacatgtcaatataagatgggagaagaaaacatc
aatctaacaattaaagaacaaaaatttcaagaacttcaagaaagactcaacatggaattg
gaattaaatgagaagattaatgaagagattacccatattcaagaagaaaaacaggatatc
atcatttctttccaacatatgcagcagttacttcggcaacaaattcaagctaatactgaa
atggaggcagaattgaaggtgctaaaagaaaataatcagacccttgaaagagataatgag
ctgcaaagggagaaggtaaaagaaaatgaagaaaagtttcttaatcttcaaaatgagcat
gaaaaagcactaggaacttggaaaagacatgctgaagaacttaatggagaaattaataag
attaaaaatgaattatcatcccttaaagaaactcatattaagttacaagaacattataac
aaattatgcaatcaaaaaacatttgaggaagacaaaaagtttcagaatgttccagaagta
aataatgaaaacagtgaaatgtcaactgaaaaatcagaaaacaccattatacagaaatat
aatactgagcaagaaataagggaagaaaatatggagaatttttgttcagatactgaatac
agagaaaaagaagaaaaaaaagaaggctcatttatagaggaaataattatagatgattta
cagctttttgaaaaaagcttcaagaatgaaattgatactgttgtttctcaggatgaaaat
caaagtgaaatctccttaagcaaaaccctctccttagataaagaagtaattagtcaagga
caaacctcgaatgttacggacaacagaaaatcagttactacagaaataaaagacaagata
tgcttggaaaaagacaatggatgtacagaatttaaatcaccaaataatcattttgtagtg
ttagatacagcaatagaaacagaaaaaatacatctagaaagaaccagaggattagatgtt
caccatacagatgtaaatctggaggttgaaaataacaaaacatcatttaacagtatttta
aatgagacagcacacaatacatatcacaataataataaagatgtttctgaaaatgagcca
ttcaaacaattcagattgcttccagggactcgagaacatgctctagagaaggaaattaca
aatagtgaccaaaccaaagcagatttggactcgtctctagatataaaaaaaaatcctgtt
ccatgtcagaaatatagtttacggaattcaagtaatgttatgttagatgataaacaatgt
aaaataaaacaaatacaactgttaactaaaaaaagtgagtgcagcatattactttctaaa
caaacttcagattttctgcaagtctgtaatgatactttagagaaatctgaactaactgtt
ccctgtgatatagtaatcgaccaccatgtttcatatgctgcttttagtgctaattcaaaa
ctacttctgaagaactcagataaaaatgtccatagtatgtctatgttggtgaaacctaac
tcaagccctgggggaaaaactatgtgtaaaaatatgagtgatatgcaaaacagtcaattt
aataactgtttgggatacttagaaaacactaatgtgaacatttcccatcttcatcttaac
aatgagaatagtcatgcttcacaagccaaagatgtgaaaactgctgttcacatgaaaact
tgcacagaaacagagttttccaataaaaagaatcagattgatgagaatcaggtaactgaa
gccacaaaaaatgacctcttcctttttgtgagcattaatgaaagacagcatacattgtta
aataatacagagaaaacagaatcattaaatgacattgtttcaggaaaaatgttcagtgaa
ggacagctggaggaatcacattcatttcacatagagccatctggagatttagtaaacaga
agcggaaggtcaacctttgatctttcaacttcagataaaaaaactgagaaaactccagta
tacatgaatttttcagaccccggtccttggtcaaaagtaaatcacattgaaagtcaaaca
gcgagcagttcgaccccttgcatttctttgttgctgaaggagagaccactagatccatca
gaaaacaaaaagatcatttcaatggctctttgtaaaaatattggtgtggatgatgttgga
aaggatattggaccagatactaccagcattaacagagttgctgacactttgaataactgg
agtatccatccagatcccaagggagaacccagtgaagagaagaatgcaatggcaaagact
ttttatgattcctcttttcccacagaacatgtgaaaacaaagcctctgatatcaactcca
ctacaaagccatttgcaggcaatcaagacgactaaaaatacttctggtgatgatgactgg
cagagcctcattacgaatcaactaaataaaagtgaaaatttactaagtttagaaaatgac
aaccagccaaagaaaagaaaagcagaagagacgttggaaaaaaacaacagattaaaataa

DBGET integrated database retrieval system