KEGG   Homo sapiens (human): 493869Help
Entry
493869            CDS       T01001                                 

Gene name
GPX8, EPLA847, GPx-8, GSHPx-8, UNQ847
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    493869 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    493869 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    493869 (GPX8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     493869 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 493869
NCBI-ProteinID: NP_001008398
OMIM: 617172
HGNC: 33100
Ensembl: ENSG00000164294
Vega: OTTHUMG00000162601
Pharos: Q8TED1(Tbio)
UniProt: Q8TED1
Structure
PDB: 

Position
5q11.2
AA seq 209 aa AA seqDB search
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WKPEEPIEVIRPDIAALVRQVIIKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcttgcagcttacccgctaaaatgttccgggcccagagcaaaggtatttgca
gttttgctgtctatagttctatgcacagtaacgctatttcttctacaactaaaattcctc
aaacctaaaatcaacagcttttatgcctttgaagtgaaggatgcaaaaggaagaactgtt
tctctggaaaagtataaaggcaaagtttcactagttgtaaacgtggccagtgactgccaa
ctcacagacagaaattacttagggctgaaggaactgcacaaagagtttggaccatcccac
ttcagcgtgttggcttttccctgcaatcagtttggagaatcggagccccgcccaagcaag
gaagtagaatcttttgcaagaaaaaactacggagtaactttccccatcttccacaagatt
aagattctaggatctgaaggagaacctgcatttagatttcttgttgattcttcaaagaag
gaaccaaggtggaatttttggaagtatcttgtcaaccctgagggtcaagttgtgaagttc
tggaagccagaggagcccattgaagtcatcaggcctgacatagcagctctggttagacaa
gtgatcataaaaaagaaagaggatctatga

DBGET integrated database retrieval system