KEGG   Homo sapiens (human): 493901Help
Entry
493901            CDS       T01001                                 

Gene name
RNASE12, HEL-S-85p, RAI1
Definition
(RefSeq) ribonuclease A family member 12 (inactive)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 493901
NCBI-ProteinID: NP_001019993
HGNC: 24211
Ensembl: ENSG00000258436
Vega: OTTHUMG00000170991
Pharos: Q5GAN4(Tdark)
UniProt: Q5GAN4 W0UV30
Position
14q11.2
AA seq 147 aa AA seqDB search
MIIMVIIFLVLLFWENEVNDEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDH
TCKKEHVFIHERPRKINGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACR
YHYSPTEGFVLVTCDDLRPDSFLGYVK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgataataatggtgataattttcttggtgcttctgttctgggaaaatgaggtgaatgat
gaagcagtgatgtcaactttagaacacttgcatgtggactaccctcagaatgacgttccc
gttcctgcaaggtactgcaaccacatgatcatacaaagagttatcagggaacctgaccac
acttgtaaaaaggagcatgtcttcatccatgagaggcctcgaaaaatcaatggtatttgc
atttctcccaagaaggttgcttgccaaaacctttcggccattttctgctttcagagtgag
acaaagttcaaaatgacagtctgtcagctcattgaaggcacaagataccctgcctgcagg
taccactattcccccacagaggggtttgttcttgtcacttgtgatgacttgaggccagat
agtttccttggctatgttaaataa

DBGET integrated database retrieval system