KEGG   Homo sapiens (human): 493911
Entry
493911            CDS       T01001                                 
Symbol
PHOSPHO2
Name
(RefSeq) phosphatase, orphan 2
  KO
K13248  pyridoxal phosphate phosphatase PHOSPHO2 [EC:3.1.3.74]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00750  Vitamin B6 metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    493911 (PHOSPHO2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    493911 (PHOSPHO2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.74  pyridoxal phosphatase
     493911 (PHOSPHO2)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   493911 (PHOSPHO2)
SSDB
Motif
Pfam: Put_Phosphatase HAD HAD_2 Ta1207
Other DBs
NCBI-GeneID: 493911
NCBI-ProteinID: NP_001008489
HGNC: 28316
Ensembl: ENSG00000144362
Vega: OTTHUMG00000153981
Pharos: Q8TCD6(Tbio)
UniProt: Q8TCD6
Position
2:169694469..169701708
AA seq 241 aa
MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGV
REHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDK
VFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDG
GNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLIK
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaaaattttgctagtttttgactttgacaatacaatcatagatgacaatagtgacact
tggattgtacaatgtgctcccaacaaaaagcttcctattgaactacgtgattcttatcga
aaaggattttggacagaatttatgggcagagtctttaagtatttgggagataagggtgta
agagaacatgaaatgaaaagagcagtgacatcattgcctttcactccagggatggtggaa
ctcttcaactttataagaaagaataaggataaatttgactgcattattatttcagattca
aattcggtcttcatagattgggttttagaagctgccagttttcatgacatatttgataaa
gtgtttacaaatccagcagcttttaatagcaatggtcatctcactgttgaaaattatcat
actcattcttgcaatagatgcccaaagaatctttgcaaaaaggtagttttgatagaattt
gtagataaacagttacaacagggagtgaattatacacaaattgtttatattggtgatggt
ggaaatgatgtctgtccagtcacctttttaaagaatgatgatgttgccatgccacggaaa
ggatataccttacagaaaactctttccagaatgtctcaaaatcttgagcctatggaatat
tctgttgtagtttggtcctcaggtgttgatataatttctcatttacaatttctaataaag
gattaa

DBGET integrated database retrieval system