KEGG   Homo sapiens (human): 494115
Entry
494115            CDS       T01001                                 

Gene name
RBMXL1, RBM1
Definition
(RefSeq) RBMX like 1
  KO
K12885  heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    494115 (RBMXL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    494115 (RBMXL1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    494115 (RBMXL1)
SSDB
Motif
Pfam: RRM_1 RBM1CTR RRM_7 RRM_occluded PHM7_cyt RRM_5
Other DBs
NCBI-GeneID: 494115
NCBI-ProteinID: NP_001156008
HGNC: 25073
Ensembl: ENSG00000213516
Vega: OTTHUMG00000010661
Pharos: Q96E39(Tdark)
UniProt: Q96E39
Position
1p22.2
AA seq 390 aa
MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGR
APLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSR
DSYSSSSRGAPRGAGPGGSRSDRGGGRSRY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaat
gagaaagctcttgaaacagtatttggcaaatatggacgaatagtggaagtactcttgata
aaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagca
gacgctaaggatgcagccagagacatgaatggaaagtcattagatggaaaagccatcaag
gtggaacaagccaccaaaccatcatttgaaagaggtagacatggaccgcccccacctcca
agaagtagaggtcctccaagaggttttggagctggaagaggaggaagtggaggaaccagg
ggacctccttcacgaggaggacacatggatgatggtggatattccatgaattttaacatg
agttcttccaggggaccactcccagtaaaaagaggaccaccaccaagaagtgggggtcct
tctcctaagagatctgcaccttcaggactagttcgcagcagcagtggaatgggaggaaga
gctcctctatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctcccc
tctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctat
tcaagcagagattacccaagttctcgtgatacaagagattatgcaccaccaccacgagat
tatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggctat
ggcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcc
tacagagattcatatgagagttatggtaactcacgtagtgctccacttacacgagggccc
ccgccatcttatggtggaagcagtcgctatgatgattatagcagctcacgtgatggatat
ggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagttgtgacagg
gttggcagacaagaaagagggcttcccccttctgtagaaagggggtacccttcttcacgt
gattcctacagcagttcaagccgcggagcaccaagaggtgctggccctggaggaagccga
tctgatagagggggaggcagaagcagatactag

DBGET integrated database retrieval system