KEGG   Homo sapiens (human): 4942Help
Entry
4942              CDS       T01001                                 

Gene name
OAT, GACR, HOGA, OATASE, OKT
Definition
(RefSeq) ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Disease
H00189  Ornithinaemia
H01400  Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4942 (OAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    4942 (OAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     4942 (OAT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class III
   4942 (OAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Gp-FAR-1
Motif
Other DBs
NCBI-GeneID: 4942
NCBI-ProteinID: NP_000265
OMIM: 613349
HGNC: 8091
Ensembl: ENSG00000065154
Vega: OTTHUMG00000019213
Pharos: P04181(Tbio)
UniProt: P04181 A0A140VJQ4
Structure
PDB: 

Position
10q26.13
AA seq 439 aa AA seqDB search
MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPV
ALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVL
GEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGR
TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVV
PDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYP
VSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNEL
MKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
KEDELRESIEIINKTILSF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttttccaaactagcacatttgcagaggtttgctgtacttagtcgcggagttcattct
tcagtggcttctgctacatctgttgcaactaaaaaaacagtccaaggccctccaacctct
gatgacatttttgaaagggaatataagtatggtgcacacaactaccatcctttacctgta
gccctggagagaggaaaaggtatttacttatgggatgtagaaggcagaaaatattttgac
ttcctgagttcttacagtgctgtcaaccaagggcattgtcaccccaagattgtgaatgct
ctgaagagtcaagtggacaaattgaccttaacatctagagctttctataataacgtactt
ggtgaatatgaggagtatattactaaacttttcaactaccacaaagttcttcctatgaat
acaggagtggaggctggagagactgcctgtaaactagctcgtaagtggggctataccgtg
aagggcattcagaaatacaaagcaaagattgtttttgcagctgggaacttctggggtagg
acgttgtctgctatctccagttccacagacccaaccagttacgatggttttggaccattt
atgccgggattcgacatcattccctataatgatctgcccgcactggagcgtgctcttcag
gatccaaatgtggctgcgttcatggtagaaccaattcagggtgaagcaggcgttgttgtt
ccggatccaggttacctaatgggagtgcgagagctctgcaccaggcaccaggttctcttt
attgctgatgaaatacagacaggattggccagaactggtagatggctggctgttgattat
gaaaatgtcagacctgatatagtcctccttggaaaggccctttctgggggcttataccct
gtgtctgcagtgctgtgtgatgatgacatcatgctgaccattaagccaggggagcatggg
tccacatacggtggcaatccactaggctgccgagtggccatcgcagcccttgaggtttta
gaagaagaaaaccttgctgaaaatgcagacaaattgggcattatcttgagaaatgaactc
atgaagctaccttctgatgttgtaactgccgtaagaggaaaaggattattaaacgctatt
gtcattaaagaaaccaaagattgggatgcttggaaggtgtgtctacgacttcgagataat
ggacttctggccaagccaacccatggcgacattatcaggtttgcgcctccgctggtgatc
aaggaggatgagcttcgagagtccattgaaattattaacaagaccatcttgtctttctga

DBGET integrated database retrieval system