KEGG   Homo sapiens (human): 4946
Entry
4946              CDS       T01001                                 
Symbol
OAZ1, AZ1, AZI, OAZ
Name
(RefSeq) ornithine decarboxylase antizyme 1
  KO
K16548  ornithine decarboxylase antizyme 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4946 (OAZ1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     4946 (OAZ1)
SSDB
Motif
Pfam: ODC_AZ
Other DBs
NCBI-GeneID: 4946
NCBI-ProteinID: NP_004143
OMIM: 601579
HGNC: 8095
Ensembl: ENSG00000104904
Pharos: P54368(Tbio)
UniProt: P54368
Structure
Position
19:2269486..2273488
AA seq 228 aa
MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNP
GPGPRWCSDAPHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQS
RLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNR
EDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEEE
NT seq 687 nt   +upstreamnt  +downstreamnt
atggtgaaatcctccctgcagcggatcctcaatagccactgcttcgccagagagaaggaa
ggggataaacccagcgccaccatccacgccagccgcaccatgccgctcctaagcctgcac
agccgcggcggcagcagcagtgagagttccagggtctccctccactgctgtagtaacccg
ggtccggggcctcggtggtgctccgatgcccctcacccacccctgaagatcccaggtggg
cgagggaatagtcagagggatcacaatctttcagctaacttattctactccgatgatcgg
ctgaatgtaacagaggaactaacgtccaacgacaagacgaggattctcaacgtccagtcc
aggctcacagacgccaaacgcattaactggcgaacagtgctgagtggcggcagcctctac
atcgagatcccgggcggcgcgctgcccgaggggagcaaggacagctttgcagttctcctg
gagttcgctgaggagcagctgcgagccgaccatgtcttcatttgcttccacaagaaccgc
gaggacagagccgccttgctccgaaccttcagctttttgggctttgagattgtgagaccg
gggcatccccttgtccccaagagacccgacgcttgcttcatggcctacacgttcgagaga
gagtcttcgggagaggaggaggagtag

DBGET integrated database retrieval system