KEGG   Homo sapiens (human): 4947
Entry
4947              CDS       T01001                                 
Symbol
OAZ2, AZ2
Name
(RefSeq) ornithine decarboxylase antizyme 2
  KO
K16613  ornithine decarboxylase antizyme 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    4947 (OAZ2)
SSDB
Motif
Pfam: ODC_AZ
Other DBs
NCBI-GeneID: 4947
NCBI-ProteinID: NP_002528
OMIM: 604152
HGNC: 8096
Ensembl: ENSG00000180304
Pharos: O95190(Tbio)
UniProt: O95190
Position
15:complement(64687574..64703281)
AA seq 189 aa
MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKD
EKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLL
ALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYP
LDQNLSDED
NT seq 570 nt   +upstreamnt  +downstreamnt
atgataaacacccaggacagtagtattttgcctttgagtaactgtccccagctccagtgc
tgcaggcacattgttccagggcctctgtggtgctccgatgcccctcacccactgtcgaag
atccccggtgggcgagggggcggcagggatccttctctctcagctctaatatataaggac
gagaagctcactgtgacccaggacctccctgtgaatgatggaaaacctcacatcgtccac
ttccagtatgaggtcaccgaggtgaaggtctcttcttgggatgcagtcctgtccagccag
agcctgtttgtagaaatcccagatggattattagctgatgggagcaaagaaggattgtta
gcactgctagagtttgctgaagagaagatgaaagtgaactatgtcttcatctgcttcagg
aagggccgagaagacagagctccactcctgaagaccttcagcttcttgggctttgagatt
gtacgtccaggccatccctgtgtcccctctcggccagatgtgatgttcatggtttatccc
ctggaccagaacttgtccgatgaggactaa

DBGET integrated database retrieval system