KEGG   Homo sapiens (human): 4952Help
Entry
4952              CDS       T01001                                 

Gene name
OCRL, INPP5F, LOCR, NPHL2, OCRL-1, OCRL1
Definition
(RefSeq) OCRL, inositol polyphosphate-5-phosphatase
  KO
K01099  inositol polyphosphate 5-phosphatase INPP5B/F [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Disease
H00692  Lowe syndrome
H00694  Dent disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4952 (OCRL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4952 (OCRL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4952 (OCRL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     4952 (OCRL)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    4952 (OCRL)
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    4952 (OCRL)
  Rab GTPases and associated proteins
   Rab associated proteins
    4952 (OCRL)
 Protein recycling
   Others
    4952 (OCRL)
 Endosome - Golgi transport
   Rab associated proteins
    4952 (OCRL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OCRL_clath_bd RhoGAP Exo_endo_phos INPP5B_PH
Motif
Other DBs
NCBI-GeneID: 4952
NCBI-ProteinID: NP_000267
OMIM: 300535
HGNC: 8108
Ensembl: ENSG00000122126
Vega: OTTHUMG00000022706
Pharos: Q01968(Tbio)
UniProt: Q01968
Structure
PDB: 

Position
Xq26.1
AA seq 901 aa AA seqDB search
MEPPLPVGAQPLATVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINS
HFRCVQEAEETLLIDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQ
LLVPEQKDSSSWYQKLDTKDKPSVFSGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPP
PFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTF
RFFVGTWNVNGQSPDSGLEPWLNCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMA
VERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAV
RFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWL
GDLNYRLCMPDANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYD
SKTDRWDSSGKCRVPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDE
RRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFS
FIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLH
LDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQM
VPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETI
PGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLM
AFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEE
D
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggagccgccgctcccggtcggagcccagccgcttgccactgtcgagggtatggagatg
aagggtcctctccgggagccctgcgccctgaccctagcccagaggaacgggcaatatgag
ttaataatccagttgcatgagaaggaacagcatgttcaagatatcattcctataaatagc
cacttcagatgtgttcaagaagcagaagaaactcttttgattgacatagcttctaacagt
ggctgcaaaattcgggttcagggggactggatcagagagcgccgctttgaaatccctgat
gaggaacactgtttgaagttcctctcagctgtccttgctgctcagaaagctcagtcacag
cttcttgttccagagcaaaaggactcatctagctggtaccagaaattagacactaaggac
aaaccttctgttttttcagggcttcttggatttgaagacaatttttcttctatgaatttg
gacaagaaaataaattcacaaaatcagcctactgggattcatcgggaacccccacctcca
cccttttcagtgaataaaatgcttccacgtgaaaaagaagcttctaacaaggagcagccc
aaagtgaccaacaccatgcggaagctctttgtaccaaatacccaatctgggcagcgggag
ggtctcatcaaacatatcctggcaaagcgagagaaagaatatgtcaacattcagactttc
agattttttgttggaacttggaatgtgaatggccagtctccagatagcgggttagaacct
tggctgaactgtgatcccaatcctcctgatatctactgcattggattccaagaactggac
ttgagcacagaagccttcttctactttgaatctgtgaaggaacaagaatggtccatggct
gtagagagaggtttgcattccaaagccaagtataagaaagttcaactggtgcgccttgtt
gggatgatgcttcttatatttgccagaaaggatcagtgtcgatacattcgtgatattgct
acagaaacagttggaactggaatcatggggaaaatgggaaacaaaggtggggtagctgtg
agatttgtatttcacaacaccaccttttgcattgtcaattcccatctggctgcacacgtg
gaggactttgagagaaggaatcaagattataaggacatttgtgcgagaatgagttttgtg
gtcccaaatcagaccctcccgcagttgaacatcatgaaacatgaggttgtcatttggttg
ggagatttgaattatagactttgcatgcctgatgccaatgaggtgaaaagtcttattaat
aagaaagaccttcagagactcttgaaattcgaccagctaaatattcagcgcacacagaaa
aaagcttttgttgacttcaatgaaggggaaatcaagttcatccccacttataagtatgac
tctaaaacagaccggtgggattccagtgggaaatgccgggttccagcctggtgtgaccga
attctttggagaggaacaaatgttaatcagcttaattatcggagtcacatggaactgaaa
accagcgaccacaagcctgttagcgccctcttccatattggggtgaaggttgtggatgaa
cgaaggtaccggaaagtctttgaagatagtgtacgcatcatggacagaatggaaaatgac
ttccttccttccttagaactcagcaggagggagtttgtgtttgaaaatgtgaagtttcgg
caactacaaaaggagaagttccagatcagcaacaatggacaggttccctgccatttttct
ttcatccctaaacttaatgacagccagtactgcaagccatggcttcgggctgaacctttt
gagggctacttggagccaaatgagacagtggacatttctcttgatgtgtatgtcagcaaa
gactctgtaaccatcctgaactcgggagaagataagattgaagatattctcgtccttcac
ctggatcgaggcaaagattacttcttgactatcagtggaaattacctcccaagttgtttt
ggcacatccttagaggctctgtgccgtatgaaaagaccaatccgagaagttcctgttacc
aaactcatagacttggaagaagacagcttcctagaaaaggagaaatcccttctgcaaatg
gttcctttggatgaaggtgccagtgagagaccccttcaggttcccaaggagatctggctt
ctagtagatcacctattcaaatacgcctgtcaccaggaggacctgttccagacccctgga
atgcaggaagagctccagcagatcattgattgtctggataccagcattcctgagacaatc
cctggcagcaaccactctgtggctgaagcactgctcattttcttggaagccctgccagag
ccagtcatctgttacgagctgtatcagcgatgtcttgactctgcttatgatccccggatc
tgccgacaggtgatctcccagcttccgagatgccatagaaatgttttccgttacttgatg
gcattccttcgagaactcttaaaattctctgaatacaatagcgtcaatgccaacatgatc
gctactctcttcactagtcttctcctgaggcctccacccaaccttatggcaagacagact
ccaagtgaccgccagcgtgctattcagttccttctgggctttctgcttgggagcgaagaa
gactaa

DBGET integrated database retrieval system