KEGG   Homo sapiens (human): 4958
Entry
4958              CDS       T01001                                 
Symbol
OMD, OSAD, SLRR2C
Name
(RefSeq) osteomodulin
  KO
K08124  osteomodulin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    4958 (OMD)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    4958 (OMD)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_6 LRRNT LRR_9
Other DBs
NCBI-GeneID: 4958
NCBI-ProteinID: NP_005005
OMIM: 618926
HGNC: 8134
Ensembl: ENSG00000127083
Pharos: Q99983(Tbio)
UniProt: Q99983
Structure
Position
9:complement(92412380..92424471)
AA seq 421 aa
MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTL
GCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEI
NLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTN
AMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSL
ENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPR
NLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTI
YYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggttttttaagtccaatatatgttattttcttcttttttggagtcaaagtacattgc
caatatgaaacttatcagtgggatgaagactatgaccaagagccagatgatgattaccaa
acaggattcccatttcgtcaaaatgtagactacggagttccttttcatcagtatacttta
ggctgtgtcagtgaatgcttctgtccaactaactttccatcatcaatgtactgtgataat
cgcaaactcaagactatcccaaatattccgatgcacattcagcaactctaccttcagttc
aatgaaattgaggctgtgactgcaaattcattcatcaatgcaactcatcttaaagaaatt
aacctcagccacaacaaaattaaatctcaaaagattgattatggtgtgtttgctaagctt
ccaaatctactacaacttcatctagagcataataatttagaagaatttccatttcctctt
cctaaatctctggaaagactccttcttggttacaatgaaatctccaaactgcagacaaat
gctatggatgggctagtaaacttgaccatgcttgatctctgttataattatcttcatgat
tctctgctaaaagacaaaatctttgccaaaatggaaaaactaatgcagctcaacctctgc
agtaacagattagaatcaatgcctcctggtttgccttcttcacttatgtatctgtcttta
gaaaataattcaatttcttctatacccgaaaaatacttcgacaaacttccaaaacttcat
actctaagaatgtcacacaacaaactacaagacatcccatataatatttttaatcttccc
aacattgtagaactcagtgttggacacaacaaattgaagcaagcattctatattccaaga
aatttggaacacctatacctacaaaataatgaaatagaaaagatgaatcttacagtgatg
tgtccttctattgacccactacattaccaccatttaacatacattcgtgtggaccaaaat
aaactaaaagaaccaataagctcatacatcttcttctgcttccctcatatacacactatt
tattatggtgaacaacgaagcactaatggtcaaacaatacaactaaagacacaagttttc
aggagatttccagatgatgatgatgaaagtgaagatcacgatgatcctgacaatgctcat
gagagcccagaacaagaaggagcagaagggcactttgaccttcattattatgaaaatcaa
gaatag

DBGET integrated database retrieval system