KEGG   Homo sapiens (human): 496
Entry
496               CDS       T01001                                 

Gene name
ATP4B, ATP6B
Definition
(RefSeq) ATPase H+/K+ transporting subunit beta
  KO
K01543  H+/K+-exchanging ATPase subunit beta [EC:7.2.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04966  Collecting duct acid secretion
hsa04971  Gastric acid secretion
Drug target
Dexlansoprazole: D08903<US>
Esomeprazole (DG00023): D01984<JP/US> D04056<US> D07917 D09339 D10120<US> D11114<US>
Lansoprazole: D00355<JP/US>
Leminoprazole: D05906
Omeprazole (DG00020): D00455<JP/US> D01207 D05259<US> D05261<JP>
Pantoprazole (DG00021): D02593<US> D05353
Penaprazole sodium hydrate: D09837
Picoprazole: D05901
Rabeprazole (DG00022): D00724<JP/US> D08463
Revaprazan hydrochloride: D05722
Tenatoprazole: D01920
Timoprazole: D05900
Vonoprazan (DG03104): D10466<JP> D11784
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    496 (ATP4B)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    496 (ATP4B)
  09155 Excretory system
   04966 Collecting duct acid secretion
    496 (ATP4B)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.19  H+/K+-exchanging ATPase
     496 (ATP4B)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 496
NCBI-ProteinID: NP_000696
OMIM: 137217
HGNC: 820
Ensembl: ENSG00000186009
Vega: OTTHUMG00000140234
Pharos: P51164(Tclin)
UniProt: P51164
Position
13q34
AA seq 291 aa
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLY
VLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGY
SPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFI
IKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
NT seq 876 nt   +upstreamnt  +downstreamnt
atggcggctctgcaggagaagaagacgtgtggccagcgcatggaggagttccagcgttac
tgctggaacccggacacggggcagatgctgggccgcaccctgtcccggtgggtgtggatc
agcctgtactacgtggccttctacgtggtgatgactgggctcttcgccctgtgcctctat
gtgctgatgcagacagtggacccgtacacaccggactaccaagaccagctacggtcacca
ggggtaaccttaaggccggatgtttacggggagaaaggcctggaaattgtctacaacgtc
tctgataacagaacctgggcagacctcacacagactctccacgccttcctagcaggctac
tctccagcagcccaggaggacagcatcaactgcacctccgagcagtacttcttccaggag
agtttccgcgctcccaaccacaccaagttctcctgcaagttcacggcagatatgctgcag
aactgctcaggcctggcggatcccaacttcggctttgaagaaggaaagccatgttttatt
attaaaatgaacaggatcgtcaagttcctccccagcaacggctcggcccccagagtggac
tgcgccttcctggaccagccccgcgagctcggccagccgctgcaggtcaagtactaccct
cccaacggcaccttcagtctgcactacttcccttattacgggaagaaagcccagccccac
tacagcaaccccctggtggcagcgaagctcctcaacatccccaggaacgctgaggtcgcc
atcgtgtgcaaggtcatggcggagcacgtgaccttcaacaatccccacgacccgtatgaa
gggaaagtggagttcaaactcaagattgagaagtga

DBGET integrated database retrieval system