KEGG   Homo sapiens (human): 4969Help
Entry
4969              CDS       T01001                                 

Gene name
OGN, OG, OIF, SLRR3A
Definition
(RefSeq) osteoglycin
  KO
K08126  osteoglycin (osteoinductive factor, mimecan)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    4969 (OGN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    4969 (OGN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_5 LRR_9
Motif
Other DBs
NCBI-GeneID: 4969
NCBI-ProteinID: NP_054776
OMIM: 602383
HGNC: 8126
Ensembl: ENSG00000106809
Vega: OTTHUMG00000020224
Pharos: P20774(Tbio)
UniProt: P20774 A8K0R3 Q7Z532 B4DI63
Position
9q22.31
AA seq 298 aa AA seqDB search
MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEK
ETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLL
KLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIH
LQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctgcagtctacacttctcctgttactgcttgtgcctctgataaagccagca
ccaccaacccagcaggactcacgcattatctatgattatggaacagataattttgaagaa
tccatatttagccaagattatgaggataaatacctggatggaaaaaatattaaggaaaaa
gaaactgtgataatacccaatgagaaaagtcttcaattacaaaaagatgaggcaataaca
ccattacctcccaagaaagaaaatgatgaaatgcccacgtgtctgctgtgtgtttgttta
agtggctctgtatactgtgaagaagttgacattgatgctgtaccacccttaccaaaggaa
tcagcctatctttacgcacgattcaacaaaattaaaaagctgactgccaaagattttgca
gacatacctaacttaagaagactcgattttacaggaaatttgatagaagatatagaagat
ggtactttttcaaaactttctctgttagaagaactttcacttgctgaaaatcaactacta
aaacttccagttcttcctcccaagctcactttatttaatgcaaaatacaacaaaatcaag
agtaggggaatcaaagcaaatgcattcaaaaaactgaataacctcaccttcctctacttg
gaccataatgccctggaatccgtgcctcttaatttaccagaaagtctacgtgtaattcat
cttcagttcaacaacatagcttcaattacagatgacacattctgcaaggctaatgacacc
agttacatccgggaccgcattgaagagatacgcctggagggcaatccaatcgtcctggga
aagcatccaaacagttttatttgcttaaaaagattaccgatagggtcatacttttaa

DBGET integrated database retrieval system