KEGG   Homo sapiens (human): 4973Help
Entry
4973              CDS       T01001                                 

Gene name
OLR1, CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
Definition
(RefSeq) oxidized low density lipoprotein receptor 1
  KO
K08763  oxidised low-density lipoprotein receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4973 (OLR1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    4973 (OLR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4973 (OLR1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    4973 (OLR1)
   04091 Lectins [BR:hsa04091]
    4973 (OLR1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    4973 (OLR1)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   4973 (OLR1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   4973 (OLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Ly49 UL45 HemX IncA FAM176 Mnd1 DUF1664 Vpu DUF4446 zf-ZPR1 DUF4239 LMBR1 Exonuc_VII_L FANCI_HD2 OSTbeta APG6 DUF1690 DUF2570 SMP_2 Bap31
Motif
Other DBs
NCBI-GeneID: 4973
NCBI-ProteinID: NP_002534
OMIM: 602601
HGNC: 8133
Ensembl: ENSG00000173391
Vega: OTTHUMG00000168527
Pharos: P78380(Tbio)
UniProt: P78380 A0A024RAU0
Structure
PDB: 

Position
12p13.2
AA seq 273 aa AA seqDB search
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL
KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgatgacctaaagatccagactgtgaaggaccagcctgatgagaagtcaaat
ggaaaaaaagctaaaggtcttcagtttctttactctccatggtggtgcctggctgctgcg
actctaggggtcctttgcctgggattagtagtgaccattatggtgctgggcatgcaatta
tcccaggtgtctgacctcctaacacaagagcaagcaaacctaactcaccagaaaaagaaa
ctggagggacagatctcagcccggcaacaagcagaagaagcttcacaggagtcagaaaac
gaactcaaggaaatgatagaaacccttgctcggaagctgaatgagaaatccaaagagcaa
atggaacttcaccaccagaatctgaatctccaagaaacactgaagagagtagcaaattgt
tcagctccttgtccgcaagactggatctggcatggagaaaactgttacctattttcctcg
ggctcatttaactgggaaaagagccaagagaagtgcttgtctttggatgccaagttgctg
aaaattaatagcacagctgatctggacttcatccagcaagcaatttcctattccagtttt
ccattctggatggggctgtctcggaggaaccccagctacccatggctctgggaggacggt
tctcctttgatgccccacttatttagagtccgaggcgctgtctcccagacatacccttca
ggtacctgtgcatatatacaacgaggagctgtttatgcggaaaactgcattttagctgcc
ttcagtatatgtcagaagaaggcaaacctaagagcacagtga

DBGET integrated database retrieval system