KEGG   Homo sapiens (human): 4974
Entry
4974              CDS       T01001                                 
Symbol
OMG, OMGP
Name
(RefSeq) oligodendrocyte myelin glycoprotein
  KO
K16666  oligodendrocyte myelin glycoprotein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    4974 (OMG)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRRNT Fasciclin SERTA LRR_5
Other DBs
NCBI-GeneID: 4974
NCBI-ProteinID: NP_002535
OMIM: 164345
HGNC: 8135
Ensembl: ENSG00000126861
Pharos: P23515(Tbio)
UniProt: P23515
Position
17:complement(31294647..31297239)
AA seq 440 aa
MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTA
YQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLT
QILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLK
WMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKV
TKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDG
MVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN
AWKVNASFLLLLNVVVMLAV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaatatcagatattgaaaatgtctctctgcctgttcatccttctgtttctcacacct
ggtattttatgcatttgtcctctccaatgtatatgcacagagaggcacaggcatgtggac
tgttcaggcagaaacttgtctacattaccatctggactgcaagagaatattatacattta
aacctgtcttataaccactttactgatctgcataaccagttaacccaatataccaatctg
aggaccctggacatttcaaacaacaggcttgaaagcctgcctgctcacttacctcggtct
ctgtggaacatgtctgctgctaacaacaacattaaacttcttgacaaatctgatactgct
tatcagtggaatcttaaatatctggatgtttctaagaacatgctggaaaaggttgtcctc
attaaaaatacactaagaagtctcgaggttctcaacctcagtagtaacaaactttggaca
gttccaaccaacatgccctccaaactacatatcgtggacctgtctaataattctttgaca
caaattcttccaggtacattaataaacctgacaaatctcacacatctttacctgcacaac
aataagttcacattcattccagaccaatcttttgaccaactctttcagttgcaagagata
accctttacaataacaggtggtcatgtgaccacaaacaaaacattacttacttactgaag
tggatgatggaaacaaaagcccatgtgatagggactccatgttctacccaaatatcatct
ttaaaggaacataacatgtatcccacaccttctggatttacctcaagcttattcactgta
agtgggatgcagacagtggacaccattaactctctgagtgtggtaactcaacccaaagtg
accaaaatacccaaacaatatcgaacaaaggaaacaacgtttggtgccactctaagcaaa
gacaccacctttactagcactgataaggcttttgtgccctatccagaagatacatccaca
gagactatcaattcacatgaagcagcagctgcaactctaactattcatctccaagatgga
atggtcacaaacacaagcctcactagctcaacaaaatcatccccaacacccatgacccta
agtatcactagtggcatgccaaataatttctctgaaatgcctcaacaaagcacaaccctt
aacttatggagggaagagacaaccacaaatgtaaagactccattaccttctgtggcaaat
gcttggaaagtaaatgcttcatttctcttattgctcaatgttgtggtcatgctggctgtc
tga

DBGET integrated database retrieval system