KEGG   Homo sapiens (human): 497661
Entry
497661            CDS       T01001                                 
Symbol
C18orf32
Name
(RefSeq) chromosome 18 open reading frame 32
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4512
Other DBs
NCBI-GeneID: 497661
NCBI-ProteinID: NP_001030177
HGNC: 31690
Ensembl: ENSG00000177576
Vega: OTTHUMG00000179688
Pharos: Q8TCD1(Tdark)
UniProt: Q8TCD1
Position
18:complement(49477243..49487234)
AA seq 76 aa
MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMN
GLPTKGPTEICDKKKD
NT seq 231 nt   +upstreamnt  +downstreamnt
atggtgtgcattccttgtatcgtcattccagttctgctctggatctacaaaaaattcctg
gagccatatatataccctctggtttcccccttcgttagtcgtatatggcctaagaaagca
atacaagaatccaatgatacaaacaaaggcaaagtaaactttaagggtgcagacatgaat
ggattaccaacaaaaggaccaacagaaatctgtgataaaaagaaagactaa

DBGET integrated database retrieval system