KEGG   Homo sapiens (human): 498Help
Entry
498               CDS       T01001                                 

Gene name
ATP5F1A, ATP5A, ATP5A1, ATP5AL2, ATPM, COXPD22, HEL-S-123m, MC5DN4, MOM2, OMR, ORM, hATP1
Definition
(RefSeq) ATP synthase F1 subunit alpha
  KO
K02132  F-type H+-transporting ATPase subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H00891  Combined oxidative phosphorylation deficiency (COXPD)
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    498 (ATP5F1A)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    498 (ATP5F1A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    498 (ATP5F1A)
   05012 Parkinson's disease
    498 (ATP5F1A)
   05016 Huntington's disease
    498 (ATP5F1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N DUF4142
Motif
Other DBs
NCBI-GeneID: 498
NCBI-ProteinID: NP_001001937
OMIM: 164360
HGNC: 823
Ensembl: ENSG00000152234
Vega: OTTHUMG00000132637
Pharos: P25705(Tbio)
UniProt: P25705 V9HW26
Position
18q21.1
AA seq 553 aa AA seqDB search
MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKL
KEIVTNFLAGFEA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgtgcgcgttgctgcggccgtggtccgcgcccttcctcggcgggccggactg
gtctccagaaatgctttgggttcatctttcattgctgcaaggaacttccatgcctctaac
actcatcttcaaaagactgggactgctgagatgtcctctattcttgaagagcgtattctt
ggagctgatacctctgttgatcttgaagaaactgggcgtgtcttaagtattggtgatggt
attgcccgcgtacatgggctgaggaatgttcaagcagaagaaatggtagagttttcttca
ggcttaaagggtatgtccttgaacttggaacctgacaatgttggtgttgtcgtgtttgga
aatgataaactaattaaggaaggagatatagtgaagaggacaggagccattgtggacgtt
ccagttggtgaggagctgttgggtcgtgtagttgatgcccttggtaatgctattgatgga
aagggtccaattggttccaagacgcgtaggcgagttggtctgaaagcccccggtatcatt
cctcgaatttcagtgcgggaaccaatgcagactggcattaaggctgtggatagcttggtg
ccaattggtcgtggtcagcgtgaactgattattggtgaccgacagactgggaaaacctca
attgctattgacacaatcattaaccagaaacgtttcaatgatggatctgatgaaaagaag
aagctgtactgtatttatgttgctattggtcaaaagagatccactgttgcccagttggtg
aagagacttacagatgcagatgccatgaagtacaccattgtggtgtcggctacggcctcg
gatgctgccccacttcagtacctggctccttactctggctgttccatgggagagtatttt
agagacaatggcaaacatgctttgatcatctatgacgacttatccaaacaggctgttgct
taccgtcagatgtctctgttgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctacactcccggttgctggagagagcagccaaaatgaacgatgcttttggt
ggtggctccttgactgctttgccagtcatagaaacacaggctggtgatgtgtctgcttac
attccaacaaatgtcatttccatcactgacggacagatcttcttggaaacagaattgttc
tacaaaggtatccgccctgcaattaacgttggtctgtctgtatctcgtgtcggatccgct
gcccaaaccagggctatgaagcaggtagcaggtaccatgaagctggaattggctcagtat
cgtgaggttgctgcttttgcccagttcggttctgacctcgatgctgccactcaacaactt
ttgagtcgtggcgtgcgtctaactgagttgctgaagcaaggacagtattctcccatggct
attgaagaacaagtggctgttatctatgcgggtgtaaggggatatcttgataaactggag
cccagcaagattacaaagtttgagaatgctttcttgtctcatgtcgtcagccagcaccaa
gccttgttgggcactatcagggctgatggaaagatctcagaacaatcagatgcaaagctg
aaagagattgtaacaaatttcttggctggatttgaagcttaa

DBGET integrated database retrieval system