KEGG   Homo sapiens (human): 4986Help
Entry
4986              CDS       T01001                                 

Gene name
OPRK1, K-OR-1, KOR, KOR-1, OPRK
Definition
(RefSeq) opioid receptor kappa 1
  KO
K04214  kappa-type opioid receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Buprenorphine (DG00820): D00836 D07132
Butorphanol (DG00821): D00837 D03197
Cyclazocine: D03618
Dezocine: D00838
Difelikefalin (DG02914): D10890 D11111
Diprenorphine (DG01273): D07863 D07864
Eluxadoline: D10403
Enadoline hydrochloride: D06395
Eptazocine (DG01340): D01879 D07904
Etorphine: D07937
Ketazocine: D04649
Ketobemidone (DG00815): D08100 D08101
Levallorphan tartrate: D02238
Loperamide (DG00092): D00729 D08144
Loperamide oxide (DG00092): D07113
Nalbuphine (DG00822): D00843 D08246
Nalfurafine: D06405
Nalmefene (DG00998): D02104 D05111 D10812
Nalorphine (DG01151): D08247 D08248
Naloxone (DG01155): D01340 D08249 D11620
Naltrexone (DG00997): D02095 D05113
Oxilorphan: D05299
Oxycodone (DG00813): D00847 D03783 D05312 D05462
Pentazocine (DG00819): D00498 D02111 D02227
Proxorphan tartrate: D05646
Quadazocine mesylate: D05667
Spiradoline mesylate: D05907
Tonazocine mesylate: D06189
Trimebutine (DG00031): D01500 D08639
Xorphanol mesylate: D06342
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4986 (OPRK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4986 (OPRK1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Opioid
    4986 (OPRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 4986
NCBI-ProteinID: NP_000903
OMIM: 165196
HGNC: 8154
Ensembl: ENSG00000082556
Vega: OTTHUMG00000164276
Pharos: P41145(Tclin)
UniProt: P41145
Position
8q11.23
AA seq 380 aa AA seqDB search
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggactccccgatccagatcttccgcggggagccgggccctacctgcgccccgagcgcc
tgcctgccccccaacagcagcgcctggtttcccggctgggccgagcccgacagcaacggc
agcgccggctcggaggacgcgcagctggagcccgcgcacatctccccggccatcccggtc
atcatcacggcggtctactccgtagtgttcgtcgtgggcttggtgggcaactcgctggtc
atgttcgtgatcatccgatacacaaagatgaagacagcaaccaacatttacatatttaac
ctggctttggcagatgctttagttactacaaccatgccctttcagagtacggtctacttg
atgaattcctggccttttggggatgtgctgtgcaagatagtaatttccattgattactac
aacatgttcaccagcatcttcaccttgaccatgatgagcgtggaccgctacattgccgtg
tgccaccccgtgaaggctttggacttccgcacacccttgaaggcaaagatcatcaatatc
tgcatctggctgctgtcgtcatctgttggcatctctgcaatagtccttggaggcaccaaa
gtcagggaagacgtcgatgtcattgagtgctccttgcagttcccagatgatgactactcc
tggtgggacctcttcatgaagatctgcgtcttcatctttgccttcgtgatccctgtcctc
atcatcatcgtctgctacaccctgatgatcctgcgtctcaagagcgtccggctcctttct
ggctcccgagagaaagatcgcaacctgcgtaggatcaccagactggtcctggtggtggtg
gcagtcttcgtcgtctgctggactcccattcacatattcatcctggtggaggctctgggg
agcacctcccacagcacagctgctctctccagctattacttctgcatcgccttaggctat
accaacagtagcctgaatcccattctctacgcctttcttgatgaaaacttcaagcggtgt
ttccgggacttctgctttccactgaagatgaggatggagcggcagagcactagcagagtc
cgaaatacagttcaggatcctgcttacctgagggacatcgatgggatgaataaaccagta
tga

DBGET integrated database retrieval system