KEGG   Homo sapiens (human): 4994
Entry
4994              CDS       T01001                                 
Symbol
OR3A1, OLFRA03, OR17-40, OR17-82, OR40
Name
(RefSeq) olfactory receptor family 3 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    4994 (OR3A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4994 (OR3A1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    4994 (OR3A1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 4994
NCBI-ProteinID: NP_002541
HGNC: 8282
Ensembl: ENSG00000180090
Pharos: P47881(Tdark)
UniProt: P47881 A0A126GVP1
Position
17:complement(3291017..3298360)
AA seq 315 aa
MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVRGNLSILAAVLVEPKLHT
PMYFFLGNLSVLDVGCISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLTA
MAYDRFLAICRPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNVINHF
YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPMALIVISYIHVAAAVLRIRSVEGRKKA
FSTCGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIYSFRNPDV
QSAIWRMLTGRRSLA
NT seq 948 nt   +upstreamnt  +downstreamnt
atgcagccagaatctggggccaatggaacagtcattgctgagttcatcctgctgggcttg
ctggaggcgccagggctgcagccagttgtctttgtgctcttcctctttgcctacctggtc
acggtcaggggcaacctcagcatcctggcagctgtcttggtggagcccaaactccacacc
cccatgtacttcttcctggggaacctatcagtgctggatgttgggtgcatcagcgtcact
gttccatcaatgttgagtcgtctcctgtcccgcaagcgtgcagttccctgtggggcctgc
cttacccagctcttcttcttccatctgttcgttggagtggactgcttcctgctgaccgcc
atggcctatgaccgattcctggccatctgccggcccctcacctacagcacccgcatgagt
cagacagtccagaggatgttggtggctgcgtcctgggcttgtgctttcaccaacgcactg
acccacactgtggccatgtccacgctcaacttctgtggccccaatgtgatcaatcacttc
tactgtgacctcccacagctcttccagctctcctgctccagcacccaactcaatgagctg
ctgctttttgctgtgggttttataatggcaggtacccccatggctctcattgtcatctcc
tatatccacgtggcagctgcagtcctgcgaattcgctctgtagagggcaggaagaaagcc
ttctccacatgtggctcccacctcactgtggttgccatattctatggttcaggtatcttt
aactatatgcgactgggttcaaccaagctttcagacaaggataaagctgttggaattttc
aacactgtcatcaatcccatgctgaacccaatcatctacagcttcagaaaccctgatgtg
cagagtgccatctggaggatgctcacagggaggcggtcactggcttga

DBGET integrated database retrieval system