KEGG   Homo sapiens (human): 4998
Entry
4998              CDS       T01001                                 

Gene name
ORC1, HSORC1, ORC1L, PARC1
Definition
(RefSeq) origin recognition complex subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4998 (ORC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4998 (ORC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4998 (ORC1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4998 (ORC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4998 (ORC1)
SSDB
Motif
Pfam: BAH AAA Cdc6_C AAA_22 AAA_16 AAA_lid_10 AAA_19 AAA_30 DUF2075 NACHT SpoU_methylas_C NB-ARC Tiam_CC_Ex
Other DBs
NCBI-GeneID: 4998
NCBI-ProteinID: NP_001177747
OMIM: 601902
HGNC: 8487
Ensembl: ENSG00000085840
Vega: OTTHUMG00000008104
Pharos: Q13415(Tbio)
UniProt: Q13415 Q96F82
Structure
PDB: 
5UJ7 5UJM

Position
1p32.3
AA seq 861 aa
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDD
ENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPAC
DSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQ
ESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELG
NLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETG
LSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKK
RDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSS
SDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLA
AQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGK
TATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAEL
LAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPE
RIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDAR
RCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRA
ILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRND
LLLRVRLNVSQDDVLYALKDE
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcacactaccccacaaggctgaagaccagaaaaacttattcatgggttggcaggccc
ttgttggatcgaaaactgcactaccaaacctatagagaaatgtgtgtgaaaacagaaggt
tgttccaccgagattcacatccagattggacagtttgtgttgattgaaggggatgatgat
gaaaacccgtatgttgctaaattgcttgagttgttcgaagatgactctgatcctcctcct
aagaaacgtgctcgagtacagtggtttgtccgattctgtgaagtccctgcctgtaaacgg
catttgttgggccggaagcctggtgcacaggaaatattctggtatgattacccggcctgt
gacagcaacattaatgcggagaccatcattggccttgttcgggtgatacctttagcccca
aaggatgtggtaccgacgaatctgaaaaatgagaagacactctttgtgaaactatcctgg
aatgagaagaaattcaggccactttcctcagaactatttgcggagttgaataaaccacaa
gagagtgcagccaagtgccagaaacccgtgagagccaagagtaagagtgcagagagccct
tcttggaccccagcagaacatgtggccaaaaggattgaatcaaggcactccgcctccaaa
tctcgccaaactcctacccatcctcttaccccaagagccagaaagaggctggagcttggc
aacttaggtaaccctcagatgtcccagcagacttcatgtgcctccttggattctccagga
agaataaaacggaaagtggccttctcggagatcacctcaccttctaagagatctcagcct
gataaacttcaaaccttgtctccagctctgaaagccccagagaaaaccagagagactgga
ctctcttatactgaggatgacaagaaggcttcacctgaacatcgcataatcctgagaacc
cgaattgcagcttcgaaaaccatagacattagagaggagagaacacttacccctatcagt
gggggacagagatcttcagtggtgccatccgtgattctgaaaccagaaaacatcaaaaag
agggatgcaaaagaagcaaaagcccagaatgaagcgacctctactccccatcgtatccgc
agaaagagttctgtcttgactatgaatcggattaggcagcagcttcggtttctaggtaat
agtaaaagtgaccaagaagagaaagagattctgccagcagcagagatttcagactctagc
agtgacgaagaagaggcttccacaccgccccttccaaggagagcacccagaactgtgtcc
aggaacctgcgatcttccttgaagtcatccttacataccctcacgaaggtgccaaagaag
agtctcaagcctagaacgccacgttgtgccgctcctcagatccgtagtcgaagcctggct
gcccaggagccagccagtgtgctggaggaagcccgactgaggctgcatgtttctgctgta
cctgagtctcttccctgtcgggaacaggaattccaagacatctacaattttgtggaaagc
aaactccttgaccataccggagggtgcatgtacatctccggtgtccctgggacagggaag
actgccactgttcatgaagtgatacgctgcctgcagcaggcagcccaagccaatgatgtt
cctccctttcaatacattgaggtcaatggcatgaagctgacggagccccaccaagtctat
gtgcaaatcttgcagaagctaacaggccaaaaagcaacagccaaccatgcggcagaactg
ctggcaaagcaattctgcacccgagggtcacctcaggaaaccaccgtcctgcttgtggat
gagctcgaccttctgtggactcacaaacaagacataatgtacaatctctttgactggccc
actcataaggaggcccggcttgtggtcctggcaattgccaacacaatggacctgccagag
cgaatcatgatgaaccgggtgtccagccgactgggtcttaccaggatgtgcttccagccc
tatacatatagccagctgcagcagatcctaaggtcccggctcaagcatctaaaggccttt
gaagatgatgccatccagctggtagccaggaaggtagcagcactgtctggagatgcacga
cggtgcctggacatctgcaggcgtgccacagagatctgtgagttctcccagcagaagcct
gactcccctggcctggtcaccatagcccactcaatggaagctgtggatgagatgttttca
tcatcatacatcacggccatcaaaaattcctctgttctggaacagagcttcctgagagcc
atcctcgcagagttccgtcgatcaggactggaggaagccacgtttcaacagatatatagt
caacatgtggcactgtgcagaatggagggactgccgtaccccaccatgtcagagaccatg
gccgtgtgttctcacctgggctcctgtcgcctcctgcttgtggagcccagcaggaacgat
ctgctccttcgggtgcggctcaacgtcagccaggatgatgtgctgtatgcgctgaaagac
gagtaa

DBGET integrated database retrieval system