KEGG   Homo sapiens (human): 5004
Entry
5004              CDS       T01001                                 

Gene name
ORM1, AGP-A, AGP1, HEL-S-153w, ORM
Definition
(RefSeq) orosomucoid 1
  KO
K17308  alpha-1-acid glycoprotein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5004 (ORM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   5004 (ORM1)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 5004
NCBI-ProteinID: NP_000598
OMIM: 138600
HGNC: 8498
Ensembl: ENSG00000229314
Vega: OTTHUMG00000021012
Pharos: P02763(Tbio)
UniProt: P02763
Structure
PDB: 
3KQ0

Position
9q32
AA seq 201 aa
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcgctgtcctgggttcttacagtcctgagcctcctacctctgctggaagcccagatc
ccattgtgtgccaacctagtaccggtgcccatcaccaacgccaccctggaccggatcact
ggcaagtggttttatatcgcatcggcctttcgaaacgaggagtacaataagtcggttcag
gagatccaagcaaccttcttttacttcacccccaacaagacagaggacacgatctttctc
agagagtaccagacccgacaggaccagtgcatctataacaccacctacctgaatgtccag
cgggaaaatgggaccatctccagatacgtgggaggccaagagcatttcgctcacttgctg
atcctcagggacaccaagacctacatgcttgcttttgacgtgaacgatgagaagaactgg
gggctgtctgtctatgctgacaagccagagacgaccaaggagcaactgggagagttctac
gaagctctcgactgcttgcgcattcccaagtcagatgtcgtgtacaccgattggaaaaag
gataagtgtgagccactggagaagcagcacgagaaggagaggaaacaggaggagggggaa
tcctag

DBGET integrated database retrieval system