KEGG   Homo sapiens (human): 5005
Entry
5005              CDS       T01001                                 

Gene name
ORM2, AGP-B, AGP-B', AGP2
Definition
(RefSeq) orosomucoid 2
  KO
K17308  alpha-1-acid glycoprotein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5005 (ORM2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   5005 (ORM2)
SSDB
Motif
Pfam: Lipocalin LRR_5
Other DBs
NCBI-GeneID: 5005
NCBI-ProteinID: NP_000599
OMIM: 138610
HGNC: 8499
Ensembl: ENSG00000228278
Vega: OTTHUMG00000021014
Pharos: P19652(Tbio)
UniProt: P19652
Structure
PDB: 
3APU 3APV 3APW 3APX

Position
9q32
AA seq 201 aa
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLL
FLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKK
DKCEPLEKQHEKERKQEEGES
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcgctgtcctgggttcttacagtcctgagcctcctacctctgctggaagcccagatc
ccattgtgtgccaacctagtaccggtgcccatcaccaacgccaccctggaccggatcact
ggcaagtggttttatatcgcatcggcctttcgaaacgaggagtacaataagtcggttcag
gagatccaagcaaccttcttttactttacccccaacaagacagaggacacgatctttctc
agagagtaccagacccgccagaaccagtgcttctataactccagttacctgaatgtccag
cgggagaatgggaccgtctccagatacgagggaggccgagaacatgttgctcacctgctg
ttccttagggacaccaagaccttgatgtttggttcctacctggacgatgagaagaactgg
gggctgtctttctatgctgacaagccagagacgaccaaggagcaactgggagagttctac
gaagctctcgactgcttgtgcattcccaggtcagatgtcatgtacaccgactggaaaaag
gataagtgtgagccactggagaagcagcacgagaaggagaggaaacaggaggagggggaa
tcctag

DBGET integrated database retrieval system