KEGG   Homo sapiens (human): 5008Help
Entry
5008              CDS       T01001                                 

Gene name
OSM
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    5008 (OSM)
   04151 PI3K-Akt signaling pathway
    5008 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5008 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5008 (OSM)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   5008 (OSM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIF_OSM
Motif
Other DBs
NCBI-GeneID: 5008
NCBI-ProteinID: NP_065391
OMIM: 165095
HGNC: 8506
Ensembl: ENSG00000099985
Vega: OTTHUMG00000150913
Pharos: P13725(Tbio)
UniProt: P13725
Structure
PDB: 

Position
22q12.2
AA seq 252 aa AA seqDB search
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMTRGQLPR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggggtactgctcacacagaggacgctgctcagtctggtccttgcactcctgtttcca
agcatggcgagcatggcggctataggcagctgctcgaaagagtaccgcgtgctccttggc
cagctccagaagcagacagatctcatgcaggacaccagcagactcctggacccctatata
cgtatccaaggcctggatgttcctaaactgagagagcactgcagggagcgccccggggcc
ttccccagtgaggagaccctgagggggctgggcaggcggggcttcctgcagaccctcaat
gccacactgggctgcgtcctgcacagactggccgacttagagcagcgcctccccaaggcc
caggatttggagaggtctgggctgaacatcgaggacttggagaagctgcagatggcgagg
ccgaacatcctcgggctcaggaacaacatctactgcatggcccagctgctggacaactca
gacacggctgagcccacgaaggctggccggggggcctctcagccgcccacccccacccct
gcctcggatgcttttcagcgcaagctggagggctgcaggttcctgcatggctaccatcgc
ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccgaaccggagccgg
agacacagcccccaccaggccctgaggaagggggtgcgcaggaccagaccctccaggaaa
ggcaagagactcatgaccaggggacagctgccccggtag

DBGET integrated database retrieval system