KEGG   Homo sapiens (human): 5010
Entry
5010              CDS       T01001                                 

Gene name
CLDN11, OSP, OTM
Definition
(RefSeq) claudin 11
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    5010 (CLDN11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5010 (CLDN11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5010 (CLDN11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5010 (CLDN11)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5010 (CLDN11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5010 (CLDN11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   5010 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   5010 (CLDN11)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 5010
NCBI-ProteinID: NP_005593
OMIM: 601326
HGNC: 8514
Ensembl: ENSG00000013297
Vega: OTTHUMG00000158940
Pharos: O75508(Tbio)
UniProt: O75508
Position
3q26.2
AA seq 207 aa
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA
QLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG
DAQAFGENRFYYTAGSSSPTHAKSAHV
NT seq 624 nt   +upstreamnt  +downstreamnt
atggtggccacgtgcctgcaggtggtgggcttcgtcacgagcttcgtgggctggatcggg
gtcatcgtgaccacctccaccaatgactgggtggtgacctgcggctacaccatccccacc
tgccgcaagctggatgagctgggctccaaggggctgtgggccgactgcgtcatggccacg
gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggctacgtgcaggcc
tgccgcgccctgatgattgctgcctcggtcctgggtctgccggccattttactgctgctg
actgttcttccctgcatccggatgggccaggagcccggtgtggctaagtacaggcgggcc
cagctggctggtgttttgctcattctgctggctctctgcgcccttgttgccaccatctgg
ttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtatgca
ggctggattggtgctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctgga
gatgcccaggcctttggtgaaaaccgtttctactacactgcgggctctagctccccgact
catgcgaagagtgcccacgtataa

DBGET integrated database retrieval system