KEGG   Homo sapiens (human): 5017
Entry
5017              CDS       T01001                                 
Symbol
OVOL1, HOVO1
Name
(RefSeq) ovo like transcriptional repressor 1
  KO
K09216  ovo
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5017 (OVOL1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    5017 (OVOL1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2H2_3rep zf-Di19 zf_C2H2_ZHX zf-H2C2_5 zf-C2HE FYVE
Other DBs
NCBI-GeneID: 5017
NCBI-ProteinID: NP_004552
OMIM: 602313
HGNC: 8525
Ensembl: ENSG00000172818
Pharos: O14753(Tbio)
UniProt: O14753
Position
11:65787063..65797214
AA seq 267 aa
MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLA
LNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTC
RVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD
KAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP
LLRKTSKKVAVALQNTVTSLLQGSPHL
NT seq 804 nt   +upstreamnt  +downstreamnt
atgccccgcgcgttcctggtgaagaagccgtgcgtctccacgtgcaagaggaactggagc
gagctccccgacgaggagcgcggcgagatctacgtgccagtcagcctgggcttctgccca
ccacagccctaccgggagccggaaccctctgtggccgaacccccttcctgcccgctggct
ttgaacatgagccttcgagactctagctacagcatggcccccgggccctgtgtggtggcc
cagctgccctctgaagacatgggccacttgacagacccccagagcagagaccatggcttc
ctgcgcaccaagatgaaggtgacccttggggacagtcccagtggagacctgttcacctgc
cgtgtctgccagaaggccttcacctaccagcgcatgctgaaccgccacatgaagtgtcac
aacgacgtcaagaggcacctctgcacgtactgcgggaagggcttcaatgacaccttcgac
ctcaagagacacgtccgaactcacactggcgtgcggccctacaagtgcagcctgtgtgac
aaggccttcacgcagcgctgctctctggagtctcacctcaagaagatccatggtgtgcag
cagaagtacgcgtacaaggagcggcgggccaagctgtacgtgtgtgaggagtgcggctgc
acatctgagagccaggagggccacgtcctgcacctgaaggagcaccaccctgacagcccg
ctgctgcgcaagacctccaagaaggtggccgtggcactacagaacactgtcacttccctg
ctgcagggcagcccccacctgtga

DBGET integrated database retrieval system