KEGG   Homo sapiens (human): 5024Help
Entry
5024              CDS       T01001                                 

Gene name
P2RX3, P2X3
Definition
(RefSeq) purinergic receptor P2X 3
  KO
K05217  P2X purinoceptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5024 (P2RX3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5024 (P2RX3)
 Organismal Systems
  Sensory system
   04742 Taste transduction
    5024 (P2RX3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   5024 (P2RX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor WAP
Motif
Other DBs
NCBI-GeneID: 5024
NCBI-ProteinID: NP_002550
OMIM: 600843
HGNC: 8534
Ensembl: ENSG00000109991
Vega: OTTHUMG00000167025
Pharos: P56373(Tchem)
UniProt: P56373
Structure
PDB: 

Position
11q12.1
AA seq 397 aa AA seqDB search
MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcatatccgacttcttcacctatgagaccaccaagtcggtggttgtgaagagc
tggaccatcgggatcatcaaccgagtagttcagcttctgatcatctcctactttgtaggg
tgggttttcttgcacgagaaggcttaccaggtacgggacacagccattgagtcctcggtg
gtaaccaaggtgaagggctccggactctacgccaacagagtcatggatgtgtctgattac
gtgacgccacctcagggcacctcggtctttgtcatcatcaccaagatgattgttactgaa
aatcagatgcaaggattctgcccagagagtgaggagaaataccgctgtgtatcagacagc
cagtgcgggcctgagcgcttgccaggtggggggatcctcactggccgctgcgtgaactac
agctctgtgctccggacctgtgagatccagggctggtgccccacggaggtggacacagtg
gaaacgcccatcatgatggaagctgagaacttcactattttcatcaagaacagcatccgt
ttccccctcttcaactttgagaagggaaacctccttcccaacctgacagccagggacatg
aagacctgccgcttccacccggacaaggaccctttctgccccatcttgcgggtaggggac
gtggtcaagtttgcggggcaggattttgccaaactggcgcgcacggggggagttctgggc
attaagatcggctgggtgtgcgacttggacaaggcctgggaccagtgcatccccaaatac
tccttcacccggctcgacagcgtttctgagaaaagcagcgtgtccccaggctacaacttc
aggtttgccaagtactacaaaatggaaaatggcagtgagtaccgcaccctcctgaaggct
tttggcatccgcttcgacgtgctggtatacgggaatgctggcaagttcaacatcatcccc
accatcatcagctctgtggcggcctttacttctgtgggagtgggaactgttctctgtgac
atcatcctgctcaacttcctcaagggggccgaccagtacaaagccaagaagtttgaggag
gtgaatgagactacgctgaaaatcgcggctttgaccaacccagtgtaccccagcgaccag
accacagcggagaagcagtccaccgattcgggggccttctccataggccactag

DBGET integrated database retrieval system