KEGG   Homo sapiens (human): 5025Help
Entry
5025              CDS       T01001                                 

Gene name
P2RX4, P2X4, P2X4R
Definition
(RefSeq) purinergic receptor P2X 4
  KO
K05218  P2X purinoceptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5025 (P2RX4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5025 (P2RX4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    5025 (P2RX4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   5025 (P2RX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor DUF3624
Motif
Other DBs
NCBI-GeneID: 5025
NCBI-ProteinID: NP_002551
OMIM: 600846
HGNC: 8535
Ensembl: ENSG00000135124
Vega: OTTHUMG00000169155
Pharos: Q99571(Tchem)
UniProt: Q99571
Position
12q24.31
AA seq 388 aa AA seqDB search
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIP
DATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAG
HSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYY
RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYC
MKKRLYYREKKYKYVEDYEQGLASELDQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctgctgcgccgcgctggcggccttcctgttcgagtacgacacgccgcgcatc
gtgctcatccgcagccgcaaagtggggctcatgaaccgcgccgtgcaactgctcatcctg
gcctacgtcatcgggtgggtgtttgtgtgggaaaagggctaccaggaaactgactccgtg
gtcagctccgttacgaccaaggtcaagggcgtggctgtgaccaacacttctaaacttgga
ttccggatctgggatgtggcggattatgtgataccagctcaggaggaaaactccctcttc
gtcatgaccaacgtgatcctcaccatgaaccagacacagggcctgtgccccgagattcca
gatgcgaccactgtgtgtaaatcagatgccagctgtactgccggctctgccggcacccac
agcaacggagtctcaacaggcaggtgcgtagctttcaacgggtctgtcaagacgtgtgag
gtggcggcctggtgcccggtggaggatgacacacacgtgccacaacctgcttttttaaag
gctgcagaaaacttcactcttttggttaagaacaacatctggtatcccaaatttaatttc
agcaagaggaatatccttcccaacatcaccactacttacctcaagtcgtgcatttatgat
gctaaaacagatcccttctgccccatattccgtcttggcaaaatagtggagaacgcagga
cacagtttccaggacatggccgtggagggaggcatcatgggcatccaggtcaactgggac
tgcaacctggacagagccgcctccctctgcttgcccaggtactccttccgccgcctcgat
acacgggacgttgagcacaacgtatctcctggctacaatttcaggtttgccaagtactac
agagacctggctggcaacgagcagcgcacgctcatcaaggcctatggcatccgcttcgac
atcattgtgtttgggaaggcagggaaatttgacatcatccccactatgatcaacatcggc
tctggcctggcactgctaggcatggcgaccgtgctgtgtgacatcatagtcctctactgc
atgaagaaaagactctactatcgggagaagaaatataaatatgtggaagattacgagcag
ggtcttgctagtgagctggaccagtga

DBGET integrated database retrieval system