KEGG   Homo sapiens (human): 5027Help
Entry
5027              CDS       T01001                                 

Gene name
P2RX7, P2X7
Definition
(RefSeq) purinergic receptor P2X 7
  KO
K05220  P2X purinoceptor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04621  NOD-like receptor signaling pathway
Drug target
Brilliant blue G: D10799
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5027 (P2RX7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5027 (P2RX7)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    5027 (P2RX7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    5027 (P2RX7)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   5027 (P2RX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor Keratin_matx Ribosomal_L5_C
Motif
Other DBs
NCBI-GeneID: 5027
NCBI-ProteinID: NP_002553
OMIM: 602566
HGNC: 8537
Ensembl: ENSG00000089041
Vega: OTTHUMG00000169153
Pharos: Q99572(Tchem)
UniProt: Q99572
Position
12q24.31
AA seq 595 aa AA seqDB search
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSS
NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG
SCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS
TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctgctgcagctgcagtgatgttttccagtatgagacgaacaaagtcactcgg
atccagagcatgaattatggcaccattaagtggttcttccacgtgatcatcttttcctac
gtttgctttgctctggtgagtgacaagctgtaccagcggaaagagcctgtcatcagttct
gtgcacaccaaggtgaaggggatagcagaggtgaaagaggagatcgtggagaatggagtg
aagaagttggtgcacagtgtctttgacaccgcagactacaccttccctttgcaggggaac
tctttcttcgtgatgacaaactttctcaaaacagaaggccaagagcagcggttgtgtccc
gagtatcccacccgcaggacgctctgttcctctgaccgaggttgtaaaaagggatggatg
gacccgcagagcaaaggaattcagaccggaaggtgtgtagtgtatgaagggaaccagaag
acctgtgaagtctctgcctggtgccccatcgaggcagtggaagaggccccccggcctgct
ctcttgaacagtgccgaaaacttcactgtgctcatcaagaacaatatcgacttccccggc
cacaactacaccacgagaaacatcctgccaggtttaaacatcacttgtaccttccacaag
actcagaatccacagtgtcccattttccgactaggagacatcttccgagaaacaggcgat
aatttttcagatgtggcaattcagggcggaataatgggcattgagatctactgggactgc
aacctagaccgttggttccatcactgccgtcccaaatacagtttccgtcgccttgacgac
aagaccaccaacgtgtccttgtaccctggctacaacttcagatacgccaagtactacaag
gaaaacaatgttgagaaacggactctgataaaagtcttcgggatccgttttgacatcctg
gtttttggcaccggaggaaaatttgacattatccagctggttgtgtacatcggctcaacc
ctctcctacttcggtctggccgctgtgttcatcgacttcctcatcgacacttactccagt
aactgctgtcgctcccatatttatccctggtgcaagtgctgtcagccctgtgtggtcaac
gaatactactacaggaagaagtgcgagtccattgtggagccaaagccgacattaaagtat
gtgtcctttgtggatgaatcccacattaggatggtgaaccagcagctactagggagaagt
ctgcaagatgtcaagggccaagaagtcccaagacctgcgatggacttcacagatttgtcc
aggctgcccctggccctccatgacacacccccgattcctggacaaccagaggagatacag
ctgcttagaaaggaggcgactcctagatccagggatagccccgtctggtgccagtgtgga
agctgcctcccatctcaactccctgagagccacaggtgcctggaggagctgtgctgccgg
aaaaagccgggggcctgcatcaccacctcagagctgttcaggaagctggtcctgtccaga
cacgtcctgcagttcctcctgctctaccaggagcccttgctggcgctggatgtggattcc
accaacagccggctgcggcactgtgcctacaggtgctacgccacctggcgcttcggctcc
caggacatggctgactttgccatcctgcccagctgctgccgctggaggatccggaaagag
tttccgaagagtgaagggcagtacagtggcttcaagagtccttactga

DBGET integrated database retrieval system