KEGG   Homo sapiens (human): 5028Help
Entry
5028              CDS       T01001                                 

Gene name
P2RY1, P2Y1, SARCC
Definition
(RefSeq) purinergic receptor P2Y1
  KO
K04270  P2Y purinoceptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04611  Platelet activation
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5028 (P2RY1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5028 (P2RY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5028 (P2RY1)
  09157 Sensory system
   04742 Taste transduction
    5028 (P2RY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5028 (P2RY1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5028 (P2RY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF4014
Motif
Other DBs
NCBI-GeneID: 5028
NCBI-ProteinID: NP_002554
OMIM: 601167
HGNC: 8539
Ensembl: ENSG00000169860
Vega: OTTHUMG00000159694
Pharos: P47900(Tchem)
UniProt: P47900
Position
3q25.2
AA seq 373 aa AA seqDB search
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtgctgtggccggctgtccccaacgggacggacgctgccttcctggccggt
ccgggttcgtcctgggggaacagcacggtcgcctccactgccgccgtctcctcgtcgttc
aaatgcgccttgaccaagacgggcttccagttttactacctgccggctgtctacatcttg
gtattcatcatcggcttcctgggcaacagcgtggccatctggatgttcgtcttccacatg
aagccctggagcggcatctccgtgtacatgttcaatttggctctggccgacttcttgtac
gtgctgactctgccagccctgatcttctactacttcaataaaacagactggatcttcggg
gatgccatgtgtaaactgcagaggttcatctttcatgtgaacctctatggcagcatcttg
tttctgacatgcatcagtgcccaccggtacagcggtgtggtgtaccccctcaagtccctg
ggccggctcaaaaagaagaatgcgatctgtatcagcgtgctggtgtggctcattgtggtg
gtggcgatctcccccatcctcttctactcaggtaccggggtccgcaaaaacaaaaccatc
acctgttacgacaccacctcagacgagtacctgcgaagttatttcatctacagcatgtgc
acgaccgtggccatgttctgtgtccccttggtgctgattctgggctgttacggattaatt
gtgagagctttgatttacaaagatctggacaactctcctctgaggagaaaatcgatttac
ctggtaatcattgtactgactgtttttgctgtgtcttacatccctttccatgtgatgaaa
acgatgaacttgagggcccggcttgattttcagaccccagcaatgtgtgctttcaatgac
agggtttatgccacgtatcaggtgacaagaggtctagcaagtctcaacagttgtgtggac
cccattctctatttcttggcgggagatactttcagaaggagactctcccgagccacaagg
aaagcttctagaagaagtgaggcaaatttgcaatccaagagtgaagacatgaccctcaat
attttacctgagttcaagcagaatggagatacaagcctgtga

DBGET integrated database retrieval system