KEGG   Homo sapiens (human): 5029Help
Entry
5029              CDS       T01001                                 

Gene name
P2RY2, HP2U, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R
Definition
(RefSeq) purinergic receptor P2Y2
  KO
K04269  P2Y purinoceptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Denufosol tetrasodium: D03685
Diquafosol tetrasodium: D03864
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5029 (P2RY2)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5029 (P2RY2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5029 (P2RY2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5029 (P2RY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 5029
NCBI-ProteinID: NP_002555
OMIM: 600041
HGNC: 8541
Ensembl: ENSG00000175591
Vega: OTTHUMG00000167966
Pharos: P41231(Tclin)
UniProt: P41231
Position
11q13.4
AA seq 377 aa AA seqDB search
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacctgggcccctggaatgacaccatcaatggcacctgggatggggatgag
ctgggctacaggtgccgcttcaacgaggacttcaagtacgtgctgctgcctgtgtcctac
ggcgtggtgtgcgtgcctgggctgtgtctgaacgccgtggcgctctacatcttcttgtgc
cgcctcaagacctggaatgcgtccaccacatatatgttccacctggctgtgtctgatgca
ctgtatgcggcctccctgccgctgctggtctattactacgcccgcggcgaccactggccc
ttcagcacggtgctctgcaagctggtgcgcttcctcttctacaccaacctttactgcagc
atcctcttcctcacctgcatcagcgtgcaccggtgtctgggcgtcttacgacctctgcgc
tccctgcgctggggccgggcccgctacgctcgccgggtggccggggccgtgtgggtgttg
gtgctggcctgccaggcccccgtgctctactttgtcaccaccagcgcgcgcgggggccgc
gtaacctgccacgacacctcggcacccgagctcttcagccgcttcgtggcctacagctca
gtcatgctgggcctgctcttcgcggtgccctttgccgtcatccttgtctgttacgtgctc
atggctcggcgactgctaaagccagcctacgggacctcgggcggcctgcctagggccaag
cgcaagtccgtgcgcaccatcgccgtggtgctggctgtcttcgccctctgcttcctgcca
ttccacgtcacccgcaccctctactactccttccgctcgctggacctcagctgccacacc
ctcaacgccatcaacatggcctacaaggttacccggccgctggccagtgctaacagttgc
cttgaccccgtgctctacttcctggctgggcagaggctcgtacgctttgcccgagatgcc
aagccacccactggccccagccctgccaccccggctcgccgcaggctgggcctgcgcaga
tccgacagaactgacatgcagaggatagaagatgtgttgggcagcagtgaggactctagg
cggacagagtccacgccggctggtagcgagaacactaaggacattcggctgtag

DBGET integrated database retrieval system