KEGG   Homo sapiens (human): 5030Help
Entry
5030              CDS       T01001                                 

Gene name
P2RY4, NRU, P2P, P2Y4, UNR
Definition
(RefSeq) pyrimidinergic receptor P2Y4
  KO
K04271  P2Y purinoceptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5030 (P2RY4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    5030 (P2RY4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5030 (P2RY4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5030 (P2RY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 5030
NCBI-ProteinID: NP_002556
OMIM: 300038
HGNC: 8542
Ensembl: ENSG00000186912
Vega: OTTHUMG00000021769
Pharos: P51582(Tchem)
UniProt: P51582
Position
Xq13.1
AA seq 365 aa AA seqDB search
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
RADRL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacagagtcctccctgttgagatccctaggcctcagcccaggtcctggcagc
agtgaggtggagctggactgttggtttgatgaggatttcaagttcatcctgctgcctgtg
agctatgcagttgtctttgtgctgggcttgggccttaacgccccaaccctatggctcttc
atcttccgcctccgaccctgggatgcaacggccacctacatgttccacctggcattgtca
gacaccttgtatgtgctgtcgctgcccaccctcatctactattatgcagcccacaaccac
tggccctttggcactgagatctgcaagttcgtccgctttcttttctattggaacctctac
tgcagtgtccttttcctcacctgcatcagcgtgcaccgctacctgggcatctgccaccca
cttcgggcactacgctggggccgccctcgcctcgcaggccttctctgcctggcagtttgg
ttggtcgtagccggctgcctcgtgcccaacctgttctttgtcacaaccagcaacaaaggg
accaccgtcctgtgccatgacaccactcggcctgaagagtttgaccactatgtgcacttc
agctcggcggtcatggggctgctctttggcgtgccctgcctggtcactcttgtttgctat
ggactcatggctcgtcgcctgtatcagcccttgccaggctctgcacagtcgtcttctcgc
ctccgctctctccgcaccatagctgtggtgctgactgtctttgctgtctgcttcgtgcct
ttccacatcacccgcaccatttactacctggccaggctgttggaagctgactgccgagta
ctgaacattgtcaacgtggtctataaagtgactcggcccctggccagtgccaacagctgc
ctggatcctgtgctctacttgctcactggggacaaatatcgacgtcagctccgtcagctc
tgtggtggtggcaagccccagccccgcacggctgcctcttccctggcactagtgtccctg
cctgaggatagcagctgcaggtgggcggccaccccccaggacagtagctgctctactcct
agggcagatagattgtaa

DBGET integrated database retrieval system