KEGG   Homo sapiens (human): 5031Help
Entry
5031              CDS       T01001                                 

Gene name
P2RY6, P2Y6
Definition
(RefSeq) pyrimidinergic receptor P2Y6
  KO
K04272  P2Y purinoceptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5031 (P2RY6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5031 (P2RY6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5031 (P2RY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 5031
NCBI-ProteinID: NP_001264133
OMIM: 602451
HGNC: 8543
Ensembl: ENSG00000171631
Vega: OTTHUMG00000167969
Pharos: Q15077(Tchem)
UniProt: Q15077 A0A024R5I9
Position
11q13.4
AA seq 328 aa AA seqDB search
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggacaatggcacaggccaggctctgggcttgccacccaccacctgtgtctac
cgcgagaacttcaagcaactgctgctgccacctgtgtattcggcggtgctggcggctggc
ctgccgctgaacatctgtgtcattacccagatctgcacgtcccgccgggccctgacccgc
acggccgtgtacaccctaaaccttgctctggctgacctgctatatgcctgctccctgccc
ctgctcatctacaactatgcccaaggtgatcactggccctttggcgacttcgcctgccgc
ctggtccgcttcctcttctatgccaacctgcacggcagcatcctcttcctcacctgcatc
agcttccagcgctacctgggcatctgccacccgctggccccctggcacaaacgtgggggc
cgccgggctgcctggctagtgtgtgtagccgtgtggctggccgtgacaacccagtgcctg
cccacagccatcttcgctgccacaggcatccagcgtaaccgcactgtctgctatgacctc
agcccgcctgccctggccacccactatatgccctatggcatggctctcactgtcatcggc
ttcctgctgccctttgctgccctgctggcctgctactgtctcctggcctgccgcctgtgc
cgccaggatggcccggcagagcctgtggcccaggagcggcgtggcaaggcggcccgcatg
gccgtggtggtggctgctgcctttgccatcagcttcctgccttttcacatcaccaagaca
gcctacctggcagtgcgctcgacgccgggcgtcccctgcactgtattggaggcctttgca
gcggcctacaaaggcacgcggccgtttgccagtgccaacagcgtgctggaccccatcctc
ttctacttcacccagaagaagttccgccggcgaccacatgagctcctacagaaactcaca
gccaaatggcagaggcagggtcgctga

DBGET integrated database retrieval system