KEGG   Homo sapiens (human): 5032Help
Entry
5032              CDS       T01001                                 

Gene name
P2RY11, P2Y11
Definition
(RefSeq) purinergic receptor P2Y11
  KO
K08387  P2Y purinoceptor 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5032 (P2RY11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5032 (P2RY11)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5032 (P2RY11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 5032
NCBI-ProteinID: NP_002557
OMIM: 602697
HGNC: 8540
Ensembl: ENSG00000244165
Vega: OTTHUMG00000150166
Pharos: Q96G91(Tbio)
UniProt: Q96G91
Position
19p13.2
AA seq 374 aa AA seqDB search
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI
TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC
SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV
AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA
APKPSEPQSRELSQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacgtctcgggtgccaagtcctgccctgccaacttcttggcagctgccgac
gacaaactcagtgggttccagggggacttcctgtggcccatactggtggttgagttcctg
gtggccgtggccagcaatggcctggccctgtaccgcttcagcatccggaagcagcgccca
tggcaccccgccgtggtcttctctgtccagctggcagtcagcgacctgctctgcgccctg
acgctgcccccgctggccgcctacctctatccccccaagcactggcgctatggggaggcc
gcgtgccgcctggagcgcttcctcttcacctgcaacctgctgggcagcgtcatcttcatc
acctgcatcagcctcaaccgctacctgggcatcgtgcaccccttcttcgcccgaagccac
ctgcgacccaagcacgcctgggccgtgagcgctgccggctgggtcctggccgccctgctg
gccatgcccacactcagcttctcccacctgaagaggccgcagcagggggcgggcaactgc
agcgtggccaggcccgaggcctgcatcaagtgtctggggacagcagaccacgggctggcg
gcctacagagcgtatagcctggtgctggcggggttgggctgcggcctgccgctgctgctc
acgctggcagcctacggcgccctcgggcgggccgtgctacgcagcccaggcatgactgtg
gccgagaagctgcgtgtggcagcgttggtggccagtggtgtggccctctacgccagctcc
tatgtgccctaccacatcatgcgggtgctcaacgtggatgctcggcggcgctggagcacc
cgctgcccgagctttgcagacatagcccaggccacagcagccctggagctggggccctac
gtgggctaccaggtgatgcggggcctcatgcccctggccttctgtgtccaccctctactc
tacatggccgcagtgcccagcctgggctgctgctgccgacactgccccggctacagggac
agctggaacccagaggacgccaagagcactggccaagccctgcccctcaatgccacagcc
gcccctaaaccgtcagagccccagtcccgtgagctgagccaatga

DBGET integrated database retrieval system