KEGG   Homo sapiens (human): 503614
Entry
503614            CDS       T01001                                 

Gene name
DEFB107B, HsT21816
Definition
(RefSeq) defensin beta 107B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2 Defensin_beta
Other DBs
NCBI-GeneID: 503614
NCBI-ProteinID: NP_001035795
HGNC: 31918
Ensembl: ENSG00000198129
Vega: OTTHUMG00000149987
Pharos: Q8IZN7(Tdark)
UniProt: Q8IZN7
Position
8p23.1
AA seq 70 aa
MPGAMKIFVFILAALILLAQIFQARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELA
PFCCKNRKKH
NT seq 213 nt   +upstreamnt  +downstreamnt
atgcctggagccatgaaaatatttgtctttattttggctgctctcattcttcttgctcaa
attttccaagccaggacagcaattcatagagcactaattagtaagagaatggaaggtcac
tgtgaagccgaatgtcttacctttgaagtaaagattgggggctgtagagctgaattagca
ccattttgctgcaaaaacagaaagaaacattaa

DBGET integrated database retrieval system