KEGG   Homo sapiens (human): 5037Help
Entry
5037              CDS       T01001                                 

Gene name
PEBP1, HCNP, HCNPpp, HEL-210, HEL-S-34, HEL-S-96, PBP, PEBP, PEBP-1, RKIP
Definition
(RefSeq) phosphatidylethanolamine binding protein 1
  KO
K06910  phosphatidylethanolamine-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5037 (PEBP1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I51: IC family
   5037 (PEBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBP
Motif
Other DBs
NCBI-GeneID: 5037
NCBI-ProteinID: NP_002558
OMIM: 604591
HGNC: 8630
Ensembl: ENSG00000089220
Vega: OTTHUMG00000168860
Pharos: P30086(Tbio)
UniProt: P30086 D9IAI1
Structure
PDB: 

Position
12q24.23
AA seq 187 aa AA seqDB search
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDS
GKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRY
VWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKL
YEQLSGK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggacctcagcaagtggtccgggcccttgagcctgcaagaagtggacgagcag
ccgcagcacccgctgcatgtcacctacgccggggcggcggtggacgagctgggcaaagtg
ctgacgcccacccaggttaagaatagacccaccagcatttcgtgggatggtcttgattca
gggaagctctacaccttggtcctgacagacccggatgctcccagcaggaaggatcccaaa
tacagagaatggcatcatttcctggtggtcaacatgaagggcaatgacatcagcagtggc
acagtcctctccgattatgtgggctcggggcctcccaagggcacaggcctccaccgctat
gtctggctggtttacgagcaggacaggccgctaaagtgtgacgagcccatcctcagcaac
cgatctggagaccaccgtggcaaattcaaggtggcgtccttccgtaaaaagtatgagctc
agggccccggtggctggcacgtgttaccaggccgagtgggatgactatgtgcccaaactg
tacgagcagctgtctgggaagtag

DBGET integrated database retrieval system