KEGG   Homo sapiens (human): 503841Help
Entry
503841            CDS       T01001                                 

Gene name
DEFB106B, BD-6, DEFB-6
Definition
(RefSeq) defensin beta 106B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2
Motif
Other DBs
NCBI-GeneID: 503841
NCBI-ProteinID: NP_001035794
HGNC: 28879
Ensembl: ENSG00000187082
Vega: OTTHUMG00000129312
Pharos: Q8N104(Tdark)
UniProt: Q8N104
Structure
PDB: 

Position
8p23.1
AA seq 65 aa AA seqDB search
MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPC
GSIID
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaggactttcctctttctctttgccgtgctcttctttctgaccccagccaagaatgca
ttttttgatgagaaatgcaacaaacttaaagggacatgcaagaacaattgcgggaaaaat
gaagaacttattgctctctgccagaagtctctgaaatgctgtcggaccatccagccatgt
gggagcattatagattaa

DBGET integrated database retrieval system