KEGG   Homo sapiens (human): 504180Help
Entry
504180            CDS       T01001                                 

Gene name
DEFB105B, BD-5, DEFB-5
Definition
(RefSeq) defensin beta 105B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2
Motif
Other DBs
NCBI-GeneID: 504180
NCBI-ProteinID: NP_001035793
HGNC: 29930
Ensembl: ENSG00000186599
Vega: OTTHUMG00000129315
Pharos: Q8NG35(Tdark)
UniProt: Q8NG35 A0A0K0K1I4 B2RU30
Position
8p23.1
AA seq 78 aa AA seqDB search
MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLEN
EKPDGNCRLNFLCCRQRI
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatcaggaagacattttattttctatttgctatgttcttcattttggttcaa
ctgccatcagggtgccaggcaggacttgatttttcccaaccatttccatcaggtgagttt
gctgtctgtgagtcgtgcaagcttggtcggggaaaatgcaggaaggagtgcttggagaat
gagaagcccgatggaaattgcaggctgaactttctctgctgcagacagaggatctga

DBGET integrated database retrieval system