KEGG   Homo sapiens (human): 504190
Entry
504190            CDS       T01001                                 

Gene name
OR8U9
Definition
(RefSeq) olfactory receptor family 8 subfamily U member 9
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    504190 (OR8U9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    504190 (OR8U9)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    504190 (OR8U9)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 504190
NCBI-ProteinID: NP_001013375
HGNC: 29166
Pharos: P0C7N5(Tdark)
UniProt: P0C7N5
Position
11q1
AA seq 309 aa
MTQINCTQVTEFILVGLTDRQELKMPLFVLFLSIYLFTVVGNLGLILLIRTDEKLNTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNSISFNACAAQLGCFLAFMTAECLLLASMAY
DRYVAICNPLMYMVVMSPGICIQLVAAPHSYSILVALFHTILTFRLSYCHSNIVNHFYCD
DMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFST
CGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEA
LKKIIINKN
NT seq 930 nt   +upstreamnt  +downstreamnt
atgactcagatcaattgcacccaggtgacagagtttattcttgtgggcctcacagatcgt
caggagttgaagatgcccctctttgtgctattcttatctatctatcttttcacagtagta
ggcaatctgggtttgatcctactcattagaacagatgaaaaactcaacacaccaatgtac
ttctttcttagcaacctagcttttgtggatttctgttactcttctgtcattacacccaaa
atgcttgggaatttcttatataaacaaaatagtatttcgttcaatgcatgtgctgctcag
ttaggctgtttcctggccttcatgacggctgagtgcttgctactggcttccatggcctat
gaccgatatgtggccatttgtaaccctctgatgtatatggtggtaatgtccccaggaatc
tgcattcagcttgtggctgctccccatagctatagcatcttggttgcactgtttcacacc
atcctcaccttccgcctctcctattgccactccaacattgtcaaccatttctattgtgat
gacatgcctctcctcaggctaacttgctcagacactcgcttcaaacagctctggatcttt
gcctgtgctggtatcatgttcatttcctcccttctgattgtctttgtctcctacatgttc
atcatttctgccatcctgaggatgcattcagctgagggaagacagaaggctttctcgacg
tgtggctctcacatgctggcagtcaccatattctatgggaccctcatttttatgtactta
cagcctagctctagccatgccctggacacagacaagatggcctctgtcttctacacagtg
atcattcccatgttgaatcccttaatctatagcctccagaataaggaggtgaaagaagct
ctgaagaaaatcattatcaataaaaactag

DBGET integrated database retrieval system