KEGG   Homo sapiens (human): 5045Help
Entry
5045              CDS       T01001                                 

Gene name
FURIN, FUR, PACE, PCSK3, SPC1
Definition
(RefSeq) furin, paired basic amino acid cleaving enzyme
  KO
K01349  furin [EC:3.4.21.75]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    5045 (FURIN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5045 (FURIN)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5045 (FURIN)
   04131 Membrane trafficking [BR:hsa04131]
    5045 (FURIN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.75  furin
     5045 (FURIN)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S8: subtilisin family
   5045 (FURIN)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Subtilisin family
   5045 (FURIN)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   Others
    5045 (FURIN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Furin-like_2 VSP DUF357
Motif
Other DBs
NCBI-GeneID: 5045
NCBI-ProteinID: NP_001276752
OMIM: 136950
HGNC: 8568
Ensembl: ENSG00000140564
Vega: OTTHUMG00000149831
Pharos: P09958(Tchem)
UniProt: P09958 A0A024RC70
Structure
PDB: 

Position
15q26.1
AA seq 794 aa AA seqDB search
MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaggccctggttgctatgggtggtagcagcaacaggaaccttggtcctgcta
gcagctgatgctcagggccagaaggtcttcaccaacacgtgggctgtgcgcatccctgga
ggcccagcggtggccaacagtgtggcacggaagcatgggttcctcaacctgggccagatc
ttcggggactattaccacttctggcatcgaggagtgacgaagcggtccctgtcgcctcac
cgcccgcggcacagccggctgcagagggagcctcaagtacagtggctggaacagcaggtg
gcaaagcgacggactaaacgggacgtgtaccaggagcccacagaccccaagtttcctcag
cagtggtacctgtctggtgtcactcagcgggacctgaatgtgaaggcggcctgggcgcag
ggctacacagggcacggcattgtggtctccattctggacgatggcatcgagaagaaccac
ccggacttggcaggcaattatgatcctggggccagttttgatgtcaatgaccaggaccct
gacccccagcctcggtacacacagatgaatgacaacaggcacggcacacggtgtgcgggg
gaagtggctgcggtggccaacaacggtgtctgtggtgtaggtgtggcctacaacgcccgc
attggaggggtgcgcatgctggatggcgaggtgacagatgcagtggaggcacgctcgctg
ggcctgaaccccaaccacatccacatctacagtgccagctggggccccgaggatgacggc
aagacagtggatgggccagcccgcctcgccgaggaggccttcttccgtggggttagccag
ggccgaggggggctgggctccatctttgtctgggcctcggggaacgggggccgggaacat
gacagctgcaactgcgacggctacaccaacagtatctacacgctgtccatcagcagcgcc
acgcagtttggcaacgtgccgtggtacagcgaggcctgctcgtccacactggccacgacc
tacagcagtggcaaccagaatgagaagcagatcgtgacgactgacttgcggcagaagtgc
acggagtctcacacgggcacctcagcctctgcccccttagcagccggcatcattgctctc
accctggaggccaataagaacctcacatggcgggacatgcaacacctggtggtacagacc
tcgaagccagcccacctcaatgccaacgactgggccaccaatggtgtgggccggaaagtg
agccactcatatggctacgggcttttggacgcaggcgccatggtggccctggcccagaat
tggaccacagtggccccccagcggaagtgcatcatcgacatcctcaccgagcccaaagac
atcgggaaacggctcgaggtgcggaagaccgtgaccgcgtgcctgggcgagcccaaccac
atcactcggctggagcacgctcaggcgcggctcaccctgtcctataatcgccgtggcgac
ctggccatccacctggtcagccccatgggcacccgctccaccctgctggcagccaggcca
catgactactccgcagatgggtttaatgactgggccttcatgacaactcattcctgggat
gaggatccctctggcgagtgggtcctagagattgaaaacaccagcgaagccaacaactat
gggacgctgaccaagttcaccctcgtactctatggcaccgcccctgaggggctgcccgta
cctccagaaagcagtggctgcaagaccctcacgtccagtcaggcctgtgtggtgtgcgag
gaaggcttctccctgcaccagaagagctgtgtccagcactgccctccagggttcgccccc
caagtcctcgatacgcactatagcaccgagaatgacgtggagaccatccgggccagcgtc
tgcgccccctgccacgcctcatgtgccacatgccaggggccggccctgacagactgcctc
agctgccccagccacgcctccttggaccctgtggagcagacttgctcccggcaaagccag
agcagccgagagtccccgccacagcagcagccacctcggctgcccccggaggtggaggcg
gggcaacggctgcgggcagggctgctgccctcacacctgcctgaggtggtggccggcctc
agctgcgccttcatcgtgctggtcttcgtcactgtcttcctggtcctgcagctgcgctct
ggctttagttttcggggggtgaaggtgtacaccatggaccgtggcctcatctcctacaag
gggctgccccctgaagcctggcaggaggagtgcccgtctgactcagaagaggacgagggc
cggggcgagaggaccgcctttatcaaagaccagagcgccctctga

DBGET integrated database retrieval system