KEGG   Homo sapiens (human): 5047Help
Entry
5047              CDS       T01001                                 

Gene name
PAEP, GD, GdA, GdF, GdS, PAEG, PEP, PP14, ZIF-1
Definition
(RefSeq) progestagen associated endometrial protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 5047
NCBI-ProteinID: NP_001018059
OMIM: 173310
HGNC: 8573
Ensembl: ENSG00000122133
Vega: OTTHUMG00000020914
Pharos: P09466(Tbio)
UniProt: P09466 A0A024R8D8
Structure
PDB: 

Position
9q34.3
AA seq 180 aa AA seqDB search
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH
ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF
LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcctcctgctcaccctgggcgtggccctggtctgtggtgtcccggccatggac
atcccccagaccaagcaggacctggagctcccaaagttggcagggacctggcactccatg
gccatggcgaccaacaacatctccctcatggcgacactgaaggcccctctgagggtccac
atcacctcactgttgcccacccccgaggacaacctggagatcgttctgcacagatgggag
aacaacagctgtgttgagaagaaggtccttggagagaagactgagaatccaaagaagttc
aagatcaactatacggtggcgaacgaggccacgctgctcgatactgactacgacaatttc
ctgtttctctgcctacaggacaccaccacccccatccagagcatgatgtgccagtacctg
gccagagtcctggtggaggacgatgagatcatgcagggattcatcagggctttcaggccc
ctgcccaggcacctatggtacttgctggacttgaaacagatggaagagccgtgccgtttc
tag

DBGET integrated database retrieval system