KEGG   Homo sapiens (human): 5048Help
Entry
5048              CDS       T01001                                 

Gene name
PAFAH1B1, LIS1, LIS2, MDCR, MDS, NudF, PAFAH
Definition
(RefSeq) platelet activating factor acetylhydrolase 1b regulatory subunit 1
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Disease
H00268  Lissencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5048 (PAFAH1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5048 (PAFAH1B1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5048 (PAFAH1B1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    5048 (PAFAH1B1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5048 (PAFAH1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 LisH eIF2A Nucleoporin_N Pox_A_type_inc LisH_2
Motif
Other DBs
NCBI-GeneID: 5048
NCBI-ProteinID: NP_000421
OMIM: 601545
HGNC: 8574
Ensembl: ENSG00000007168
Vega: OTTHUMG00000177574
Pharos: P43034(Tbio)
UniProt: P43034
Position
17p13.3
AA seq 410 aa AA seqDB search
MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIR
LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF
SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ
GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV
RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSE
TKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK
TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtcccagagacaacgagatgaactaaatcgagctatagcagattatcttcgt
tcaaatggctatgaagaggcatattcagtttttaaaaaggaagctgaattagatgtgaat
gaagaattagataaaaagtatgctggtcttttggaaaaaaaatggacatctgttattaga
ttacaaaagaaggttatggaattagaatcaaagctaaatgaagcaaaagaagaatttacg
tcaggtggacctcttggtcagaaacgagacccaaaagaatggattccccgtccgccagaa
aaatatgcattgagtggtcacaggagtccagtcactcgagtcattttccatcctgtgttc
agtgttatggtctctgcttcagaggatgctacaattaaggtgtgggattatgagactgga
gattttgaacgaactcttaaaggacatacagactctgtacaggacatttcattcgaccac
agcggcaagcttctggcttcctgttctgcagatatgaccattaaactatgggattttcag
ggctttgaatgcatcagaaccatgcacggccatgaccacaatgtttcttcagtagccatc
atgcccaatggagatcatatagtgtctgcctcaagggataaaactataaaaatgtgggaa
gtgcaaactggctactgtgtgaagacattcacaggacacagagaatgggtacgtatggta
cggccaaatcaagatggcactctgatagccagctgttccaatgaccagactgtgcgtgta
tgggtcgtagcaacaaaggaatgcaaggctgagctccgagagcatgagcatgtggtagaa
tgcatttcctgggctccagaaagctcatattcctccatctctgaagcaacaggatctgag
actaaaaaaagtggtaaacctgggccattcttgctgtctggatccagagacaagactatt
aagatgtgggatgtcagtactggcatgtgccttatgaccctcgtgggtcatgataactgg
gtacgtggagttctgttccattctggggggaagtttattttgagttgtgctgatgacaag
accctacgcgtatgggattacaagaacaagcgatgcatgaagaccctcaatgcgcatgaa
cactttgttacctccttggatttccacaagacggcaccctatgtcgtcactggcagcgta
gatcaaacagtaaaagtgtgggagtgccgttga

DBGET integrated database retrieval system