KEGG   Homo sapiens (human): 5048
Entry
5048              CDS       T01001                                 

Gene name
PAFAH1B1, LIS1, LIS2, MDCR, MDS, NudF, PAFAH
Definition
(RefSeq) platelet activating factor acetylhydrolase 1b regulatory subunit 1
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Disease
H00268  Lissencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5048 (PAFAH1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5048 (PAFAH1B1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5048 (PAFAH1B1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    5048 (PAFAH1B1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5048 (PAFAH1B1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 LisH eIF2A Nucleoporin_N Ge1_WD40 Pox_A_type_inc LisH_2
Other DBs
NCBI-GeneID: 5048
NCBI-ProteinID: NP_000421
OMIM: 601545
HGNC: 8574
Ensembl: ENSG00000007168
Vega: OTTHUMG00000177574
Pharos: P43034(Tbio)
UniProt: P43034
Position
17p13.3
AA seq 410 aa
MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIR
LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF
SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ
GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV
RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSE
TKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK
TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtgctgtcccagagacaacgagatgaactaaatcgagctatagcagattatcttcgt
tcaaatggctatgaagaggcatattcagtttttaaaaaggaagctgaattagatgtgaat
gaagaattagataaaaagtatgctggtcttttggaaaaaaaatggacatctgttattaga
ttacaaaagaaggttatggaattagaatcaaagctaaatgaagcaaaagaagaatttacg
tcaggtggacctcttggtcagaaacgagacccaaaagaatggattccccgtccgccagaa
aaatatgcattgagtggtcacaggagtccagtcactcgagtcattttccatcctgtgttc
agtgttatggtctctgcttcagaggatgctacaattaaggtgtgggattatgagactgga
gattttgaacgaactcttaaaggacatacagactctgtacaggacatttcattcgaccac
agcggcaagcttctggcttcctgttctgcagatatgaccattaaactatgggattttcag
ggctttgaatgcatcagaaccatgcacggccatgaccacaatgtttcttcagtagccatc
atgcccaatggagatcatatagtgtctgcctcaagggataaaactataaaaatgtgggaa
gtgcaaactggctactgtgtgaagacattcacaggacacagagaatgggtacgtatggta
cggccaaatcaagatggcactctgatagccagctgttccaatgaccagactgtgcgtgta
tgggtcgtagcaacaaaggaatgcaaggctgagctccgagagcatgagcatgtggtagaa
tgcatttcctgggctccagaaagctcatattcctccatctctgaagcaacaggatctgag
actaaaaaaagtggtaaacctgggccattcttgctgtctggatccagagacaagactatt
aagatgtgggatgtcagtactggcatgtgccttatgaccctcgtgggtcatgataactgg
gtacgtggagttctgttccattctggggggaagtttattttgagttgtgctgatgacaag
accctacgcgtatgggattacaagaacaagcgatgcatgaagaccctcaatgcgcatgaa
cactttgttacctccttggatttccacaagacggcaccctatgtcgtcactggcagcgta
gatcaaacagtaaaagtgtgggagtgccgttga

KEGG   Homo sapiens (human): 5049
Entry
5049              CDS       T01001                                 

Gene name
PAFAH1B2, HEL-S-303
Definition
(RefSeq) platelet activating factor acetylhydrolase 1b catalytic subunit 2
  KO
K16795  platelet-activating factor acetylhydrolase IB subunit beta/gamma [EC:3.1.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5049 (PAFAH1B2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     5049 (PAFAH1B2)
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Lipase_GDSL_3
Other DBs
NCBI-GeneID: 5049
NCBI-ProteinID: NP_002563
OMIM: 602508
HGNC: 8575
Ensembl: ENSG00000168092
Vega: OTTHUMG00000167064
Pharos: P68402(Tbio)
UniProt: P68402 V9HW44
Structure
PDB: 
1VYH

Position
11q23.3
AA seq 229 aa
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWR
ELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEA
IVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFV
HSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagccaaggagactcaaacccagcagctattccgcatgcagcagaagatattcaagga
gatgaccgatggatgtctcagcacaacagatttgttttggactgtaaagacaaagagcct
gatgtactgttcgtgggagactccatggtgcagttaatgcagcaatatgagatatggcga
gagcttttttccccacttcatgcactgaattttggaattgggggagatacaacaagacat
gttttgtggagactaaagaatggagaactggagaatattaagcctaaggtcattgttgtc
tgggtaggaacaaataaccacgaaaatacagcagaagaagtagcaggtgggatcgaggcc
attgtacaacttatcaacacaaggcagccacaggccaaaatcattgtattgggtttgtta
cctcgaggtgagaaacccaatcctttgaggcaaaagaacgccaaggtgaaccaactcctc
aaggtttcgctgccgaagcttgccaacgtgcagctcctggataccgacgggggttttgtg
cactcggacggtgccatctcctgccacgacatgtttgattttctgcatctgacaggaggg
ggctatgcaaagatctgcaaacccctgcatgaactgatcatgcagttgttggaggaaaca
cctgaggagaaacaaaccaccattgcctga

KEGG   Homo sapiens (human): 5050
Entry
5050              CDS       T01001                                 

Gene name
PAFAH1B3, PAFAHG
Definition
(RefSeq) platelet activating factor acetylhydrolase 1b catalytic subunit 3
  KO
K16795  platelet-activating factor acetylhydrolase IB subunit beta/gamma [EC:3.1.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5050 (PAFAH1B3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     5050 (PAFAH1B3)
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Lipase_GDSL_3
Other DBs
NCBI-GeneID: 5050
NCBI-ProteinID: NP_001139411
OMIM: 603074
HGNC: 8576
Ensembl: ENSG00000079462
Vega: OTTHUMG00000182795
Pharos: Q15102(Tbio)
UniProt: Q15102 A0A024R0L6
Position
19q13.2
AA seq 231 aa
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRE
LFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI
VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVH
SDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgagtggagaggagaacccagccagcaagcccacgccggtgcaggacgtacagggcgac
gggcgctggatgtccctgcaccatcggttcgtggctgacagcaaagataaggaacccgaa
gtcgtcttcatcggggactccttggtccagctcatgcaccagtgcgagatctggcgcgag
ctcttctctcctctgcatgcacttaactttggcattggtggtgacggcacacagcatgta
ctgtggcggctggagaatggggagctggaacacatccggcccaagattgtggtggtctgg
gtgggcaccaacaaccacggacacacagcagagcaggtgactggtggcatcaaggccatt
gtgcaactggtgaatgagcgacagccccaggcccgggttgtggtgctgggcctgcttccg
cgaggccaacatcccaacccacttcgggagaagaaccgacaggtgaacgagctggtacgg
gcggcactggctggccaccctcgggcccacttcctagatgccgaccctggctttgtgcac
tcagatggcaccatcagccatcatgacatgtatgattacctgcatctgagccgcctgggc
tacacacctgtttgccgggctctgcactccctgcttctgcgtctgctggcccaagaccag
ggccaaggtgctcccctgctggagcccgcaccctaa

KEGG   Homo sapiens (human): 5051
Entry
5051              CDS       T01001                                 

Gene name
PAFAH2, HSD-PLA2
Definition
(RefSeq) platelet activating factor acetylhydrolase 2
  KO
K01062  platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5051 (PAFAH2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     5051 (PAFAH2)
SSDB
Motif
Pfam: PAF-AH_p_II Chlorophyllase2 Chlorophyllase Peptidase_S9 Esterase Hydrolase_4 DLH Abhydrolase_2 Abhydrolase_6 Lipase_3 Abhydrolase_3 Abhydrolase_1 BAAT_C AXE1
Other DBs
NCBI-GeneID: 5051
NCBI-ProteinID: NP_000428
OMIM: 602344
HGNC: 8579
Ensembl: ENSG00000158006
Vega: OTTHUMG00000007437
Pharos: Q99487(Tbio)
UniProt: Q99487
Position
1p36.11
AA seq 392 aa
MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCT
GLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAF
CMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHV
RNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGA
TAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQ
HEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKH
LDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgggggtcaaccagtctgtgggctttccacctgtcacaggaccccacctcgtaggctgt
ggggatgtgatggagggtcagaatctccaggggagcttctttcgactcttctacccctgc
caaaaggcagaggagaccatggagcagcccctgtggattccccgctatgagtactgcact
ggcctggccgagtacctgcagtttaataagcgctgcgggggcttgctgttcaacctggcg
gtgggatcttgtcgcctgcctgttagctggaatggcccctttaagacaaaggactctgga
taccccttgatcatcttctcccatggcctaggagccttcaggactttgtattcagccttc
tgcatggagctggcctcacgtggctttgtggttgctgtgccagagcacagggaccggtca
gcggcaaccacctatttctgcaagcaggccccagaagagaaccagcccaccaatgaatcg
ctgcaggaggaatggatccctttccgtcgagttgaggaaggggagaaggaatttcatgtt
cggaatccccaggtgcatcagcgggtaagcgagtgtttacgggtgttgaagatcctgcaa
gaggtcactgctgggcagactgtcttcaacatcttgcctggtggcttggatctgatgact
ttgaagggcaacattgacatgagccgtgtggctgtgatgggacattcatttggaggggcc
acagctattctggctttggccaaggagacccaatttcggtgtgcggtggctctggatgct
tggatgtttcctctggaacgtgacttttaccccaaggcccgaggacctgtgttctttatc
aatactgagaaattccagacaatggagagtgtcaatttgatgaagaagatatgtgcccag
catgaacagtctaggatcataaccgttcttggttctgttcatcggagtcaaactgacttt
gcttttgtgactggcaacttgattggtaaattcttctccactgaaacccgtgggagcctg
gacccctatgaagggcaggaggttatggtacgggccatgttggccttcctgcagaagcac
ctcgacctgaaagaagactataatcaatggaacaaccttattgaaggcattggaccgtcg
ctcaccccaggggccccccaccatctgtccagcctgtag

KEGG   Homo sapiens (human): 7941
Entry
7941              CDS       T01001                                 

Gene name
PLA2G7, LDL-PLA2, LP-PLA2, PAFAD, PAFAH
Definition
(RefSeq) phospholipase A2 group VII
  KO
K01062  platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Drug target
Darapladib: D03650
Goxalapladib: D04368
Rilapladib: D05728
Varespladib (DG01394): D06283 D08107 D08221
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    7941 (PLA2G7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     7941 (PLA2G7)
SSDB
Motif
Pfam: PAF-AH_p_II Chlorophyllase2 Hydrolase_4 Abhydrolase_1 Peptidase_S9 Chlorophyllase Abhydrolase_6 Abhydrolase_2 Abhydrolase_5 DLH PGAP1 Abhydrolase_3 DUF676 Lipase_3
Other DBs
NCBI-GeneID: 7941
NCBI-ProteinID: NP_001161829
OMIM: 601690
HGNC: 9040
Ensembl: ENSG00000146070
Vega: OTTHUMG00000014789
Pharos: Q13093(Tchem)
UniProt: Q13093
Structure
PDB: 

Position
6p12.3
AA seq 441 aa
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggtgccacccaaattgcatgtgcttttctgcctctgcggctgcctggctgtggtttat
ccttttgactggcaatacataaatcctgttgcccatatgaaatcatcagcatgggtcaac
aaaatacaagtactgatggctgctgcaagctttggccaaactaaaatcccccggggaaat
gggccttattccgttggttgtacagacttaatgtttgatcacactaataagggcaccttc
ttgcgtttatattatccatcccaagataatgatcgccttgacaccctttggatcccaaat
aaagaatatttttggggtcttagcaaatttcttggaacacactggcttatgggcaacatt
ttgaggttactctttggttcaatgacaactcctgcaaactggaattcccctctgaggcct
ggtgaaaaatatccacttgttgttttttctcatggtcttggggcattcaggacactttat
tctgctattggcattgacctggcatctcatgggtttatagttgctgctgtagaacacaga
gatagatctgcatctgcaacttactatttcaaggaccaatctgctgcagaaataggggac
aagtcttggctctaccttagaaccctgaaacaagaggaggagacacatatacgaaatgag
caggtacggcaaagagcaaaagaatgttcccaagctctcagtctgattcttgacattgat
catggaaagccagtgaagaatgcattagatttaaagtttgatatggaacaactgaaggac
tctattgatagggaaaaaatagcagtaattggacattcttttggtggagcaacggttatt
cagactcttagtgaagatcagagattcagatgtggtattgccctggatgcatggatgttt
ccactgggtgatgaagtatattccagaattcctcagcccctcttttttatcaactctgaa
tatttccaatatcctgctaatatcataaaaatgaaaaaatgctactcacctgataaagaa
agaaagatgattacaatcaggggttcagtccaccagaattttgctgacttcacttttgca
actggcaaaataattggacacatgctcaaattaaagggagacatagattcaaatgtagct
attgatcttagcaacaaagcttcattagcattcttacaaaagcatttaggacttcataaa
gattttgatcagtgggactgcttgattgaaggagatgatgagaatcttattccagggacc
aacattaacacaaccaatcaacacatcatgttacagaactcttcaggaatagagaaatac
aattag

DBGET integrated database retrieval system