KEGG   Homo sapiens (human): 50484Help
Entry
50484             CDS       T01001                                 

Gene name
RRM2B, MTDPS8A, MTDPS8B, P53R2
Definition
(RefSeq) ribonucleotide reductase regulatory TP53 inducible subunit M2B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00480  Glutathione metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04115  p53 signaling pathway
Disease
H00469  Mitochondrial DNA depletion syndrome
H01118  Progressive external ophthalmoplegia
H01390  Mitochondrial neurogastrointestinal encephalomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    50484 (RRM2B)
   00240 Pyrimidine metabolism
    50484 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    50484 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    50484 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    50484 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    50484 (RRM2B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     50484 (RRM2B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    50484 (RRM2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-GeneID: 50484
NCBI-ProteinID: NP_056528
OMIM: 604712
HGNC: 17296
Ensembl: ENSG00000048392
Vega: OTTHUMG00000164776
Pharos: Q7LG56(Tbio)
UniProt: Q7LG56
Structure
PDB: 

Position
8q22.3
AA seq 351 aa AA seqDB search
MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQ
ASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFS
KVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacccggaaaggccggaagcggccgggctggatcaggatgagagatcatcttca
gacaccaacgaaagtgaaataaagtcaaatgaagagccactcctaagaaagagttctcgc
cggtttgtcatctttccaatccagtaccctgatatttggaaaatgtataaacaggcacag
gcttccttctggacagcagaagaggtcgacttatcaaaggatctccctcactggaacaag
cttaaagcagatgagaagtacttcatctctcacatcttagccttttttgcagccagtgat
ggaattgtaaatgaaaatttggtggagcgctttagtcaggaggtgcaggttccagaggct
cgctgtttctatggctttcaaattctcatcgagaatgttcactcagagatgtacagtttg
ctgatagacacttacatcagagatcccaagaaaagggaatttttatttaatgcaattgaa
accatgccctatgttaagaaaaaagcagattgggccttgcgatggatagcagatagaaaa
tctacttttggggaaagagtggtggcctttgctgctgtagaaggagttttcttctcagga
tcttttgctgctatattctggctaaagaagagaggtcttatgccaggactcactttttcc
aatgaactcatcagcagagatgaaggacttcactgtgactttgcttgcctgatgttccaa
tacttagtaaataagccttcagaagaaagggtcagggagatcattgttgatgctgtcaaa
attgagcaggagtttttaacagaagccttgccagttggcctcattggaatgaattgcatt
ttgatgaaacagtacattgagtttgtagctgacagattacttgtggaacttggattctca
aaggtttttcaggcagaaaatccttttgattttatggaaaacatttctttagaaggaaaa
acaaatttctttgagaaacgagtttcagagtatcagcgttttgcagttatggcagaaacc
acagataacgtcttcaccttggatgcagatttttaa

DBGET integrated database retrieval system