KEGG   Homo sapiens (human): 50486
Entry
50486             CDS       T01001                                 

Gene name
G0S2
Definition
(RefSeq) G0/G1 switch 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: G0-G1_switch_2 HILPDA ArAE_2_N LapA_dom
Other DBs
NCBI-GeneID: 50486
NCBI-ProteinID: NP_056529
OMIM: 614447
HGNC: 30229
Ensembl: ENSG00000123689
Vega: OTTHUMG00000036479
Pharos: P27469(Tbio)
UniProt: P27469
Position
1q32.2
AA seq 103 aa
METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQE
AAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
NT seq 312 nt   +upstreamnt  +downstreamnt
atggaaacggtccaggagctgatccccctggccaaggagatgatggcccagaagcgcaag
gggaagatggtgaagctgtacgtgctgggcagcgtgctggccctcttcggcgtggtgctc
ggcctgatggagactgtgtgcagccccttcacggccgccagacgtctgcgggaccaggag
gcagccgtggcggagctgcaggccgccctggagcgacaggctctccagaagcaagccctg
caggagaaaggcaagcagcaggacacggtcctcggcggccgggccctgtccaaccggcag
cacgcctcctag

DBGET integrated database retrieval system