KEGG   Homo sapiens (human): 50488Help
Entry
50488             CDS       T01001                                 

Gene name
MINK1, B55, MAP4K6, MINK, YSK2, ZC3
Definition
(RefSeq) misshapen like kinase 1
  KO
K04413  misshapen/NIK-related kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    50488 (MINK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     50488 (MINK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   50488 (MINK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 50488
NCBI-ProteinID: NP_722549
OMIM: 609426
HGNC: 17565
Ensembl: ENSG00000141503
Vega: OTTHUMG00000177932
Pharos: Q8N4C8(Tchem)
UniProt: Q8N4C8
Position
17p13.2
AA seq 1332 aa AA seqDB search
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNT
KGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRI
QLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGESTLRREFLRLQQ
ENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQ
QQQQQQQLQKQQQQQLLPGDRKPLYHYGRGMNPADKPAWAREVEERTRMNKQQNSPLAKS
KPGSTGPEPPIPQASPGPPGPLSQTPPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQ
SLQDQPTRNLAAFPASHDPDPAIPAPTATPSARGAVIRQNSDPTSEGPGPSPNPPAWVRP
DNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSNSAWQIYLQRRAERGTPKPPG
PPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERNRVGVSSKPDSSPV
LSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYSSSSEEVESSEDDEEEG
EGGPAEGSRDTPGGRSDGDTDSVSTMVVHDVEEITGTQPPYGGGTMVVQRTPEEERNLLH
ADSNGYTNLPDVVQPSHSPTENSKGQSPPSKDGSGDYQSRGLVKAPGKSSFTMFVDLGIY
QPGGSGDSIPITALVGGEGTRLDQLQYDVRKGSVVNVNPTNTRAHSETPEIRKYKKRFNS
EILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRRRFQQMDVLEGLNLLITISGKRN
KLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGHYRVVKYERIKFLVIALKSSVEV
YAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAVDVDSGNSYDI
YIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAY
ICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVY
FMTLNRNCIMNW
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacccagcccccgcccgcagcctggacgacatcgacctgtccgccctgcgggac
cctgctgggatctttgagcttgtggaggtggtcggcaatggaacctacggacaggtgtac
aagggtcggcatgtcaagacggggcagctggctgccatcaaggtcatggatgtcacggag
gacgaggaggaagagatcaaacaggagatcaacatgctgaaaaagtactctcaccaccgc
aacatcgccacctactacggagccttcatcaagaagagccccccgggaaacgatgaccag
ctctggctggtgatggagttctgtggtgctggttcagtgactgacctggtaaagaacaca
aaaggcaacgccctgaaggaggactgtatcgcctatatctgcagggagatcctcaggggt
ctggcccatctccatgcccacaaggtgatccatcgagacatcaaggggcagaatgtgctg
ctgacagagaatgctgaggtcaagctagtggattttggggtgagtgctcagctggaccgc
accgtgggcagacggaacactttcattgggactccctactggatggctccagaggtcatc
gcctgtgatgagaaccctgatgccacctatgattacaggagtgatatttggtctctagga
atcacagccatcgagatggcagagggagccccccctctgtgtgacatgcaccccatgcga
gccctcttcctcattcctcggaaccctccgcccaggctcaagtccaagaagtggtctaag
aagttcattgacttcattgacacatgtctcatcaagacttacctgagccgcccacccacg
gagcagctactgaagtttcccttcatccgggaccagcccacggagcggcaggtccgcatc
cagcttaaggaccacattgaccgatcccggaagaagcggggtgagaaagaggagacagaa
tatgagtacagcggcagcgaggaggaagatgacagccatggagaggaaggagagccaagc
tccatcatgaacgtgcctggagagtcgactctacgccgggagtttctccggctccagcag
gaaaataagagcaactcagaggctttaaaacagcagcagcagctgcagcagcagcagcag
cgagaccccgaggcacacatcaaacacctgctgcaccagcggcagcggcgcatagaggag
cagaaggaggagcggcgccgcgtggaggagcaacagcggcgggagcgggagcagcggaag
ctgcaggagaaggagcagcagcggcggctggaggacatgcaggctctgcggcgggaggag
gagcggcggcaggcggagcgcgagcaggaatacaagcggaagcagctggaggagcagcgg
cagtcagaacgtctccagaggcagctgcagcaggagcatgcctacctcaagtccctgcag
cagcagcaacagcagcagcagcttcagaaacagcagcagcagcagctcctgcctggggac
aggaagcccctgtaccattatggtcggggcatgaatcccgctgacaaaccagcctgggcc
cgagaggtagaagagagaacaaggatgaacaagcagcagaactctcccttggccaagagc
aagccaggcagcacggggcctgagccccccatcccccaggcctccccagggcccccagga
cccctttcccagactcctcctatgcagaggccggtggagccccaggagggaccgcacaag
agcctggtggcacaccgggtcccactgaagccatatgcagcacctgtaccccgatcccag
tccctgcaggaccagcccacccgaaacctggctgccttcccagcctcccatgaccccgac
cctgccatccccgcacccactgccacgcccagtgcccgaggagctgtcatccgccagaat
tcagaccccacctctgaaggacctggccccagcccgaatcccccagcctgggtccgccca
gataacgaggccccacccaaggtgcctcagaggacctcatctatcgccactgcccttaac
accagtggggccggagggtcccggccagcccaggcagtccgtgccagacctcgcagcaac
tccgcctggcaaatctatctgcaaaggcgggcagagcggggcaccccaaagcctccaggg
ccccctgctcagccccctggcccgcccaacgcctctagtaaccccgacctcaggaggagc
gaccctggctgggaacgctcggacagcgtccttccagcctctcacgggcacctcccccag
gctggctcactggagcggaaccgcgtgggagtctcctccaaaccggacagctcccctgtg
ctctcccctgggaataaagccaagcccgacgaccaccgctcacggccaggccggcccgca
gactttgtgttgctgaaagagcggactctggacgaggcccctcggcctcccaagaaggcc
atggactactcgtcgtccagcgaggaggtggaaagcagtgaggacgacgaggaggaaggc
gaaggcgggccagcagaggggagcagagatacccctgggggccgcagcgatggggataca
gacagcgtcagcaccatggtggtccacgacgtcgaggagatcaccgggacccagccccca
tacgggggcggcaccatggtggtccagcgcacccctgaagaggagcggaacctgctgcat
gctgacagcaatgggtacacaaacctgcctgacgtggtccagcccagccactcacccacc
gagaacagcaaaggccaaagcccaccctcgaaggatgggagtggtgactaccagtctcgt
gggctggtaaaggcccctggcaagagctcgttcacgatgtttgtggatctagggatctac
cagcctggaggcagtggggacagcatccccatcacagccctagtgggtggagagggcact
cggctcgaccagctgcagtacgacgtgaggaagggttctgtggtcaacgtgaatcccacc
aacacccgggcccacagtgagacccctgagatccggaagtacaagaagcgattcaactcc
gagatcctctgtgcagccctttggggggtcaacctgctggtgggcacggagaacgggctg
atgttgctggaccgaagtgggcagggcaaggtgtatggactcattgggcggcgacgcttc
cagcagatggatgtgctggaggggctcaacctgctcatcaccatctcagggaaaaggaac
aaactgcgggtgtattacctgtcctggctccggaacaagattctgcacaatgacccagaa
gtggagaagaagcagggctggaccaccgtgggggacatggagggctgcgggcactaccgt
gttgtgaaatacgagcggattaagttcctggtcatcgccctcaagagctccgtggaggtg
tatgcctgggcccccaaaccctaccacaaattcatggccttcaagtcctttgccgacctc
ccccaccgccctctgctggtcgacctgacagtagaggaggggcagcggctcaaggtcatc
tatggctccagtgctggcttccatgctgtggatgtcgactcggggaacagctatgacatc
tacatccctgtgcacatccagagccagatcacgccccatgccatcatcttcctccccaac
accgacggcatggagatgctgctgtgctacgaggacgagggtgtctacgtcaacacgtac
gggcgcatcattaaggatgtggtgctgcagtggggggagatgcctacttctgtggcctac
atctgctccaaccagataatgggctggggtgagaaagccattgagatccgctctgtggag
acgggccacctcgacggggtcttcatgcacaaacgagctcagaggctcaagttcctgtgt
gagcggaatgacaaggtgttttttgcctcagtccgctctgggggcagcagccaagtttac
ttcatgactctgaaccgtaactgcatcatgaactggtga

DBGET integrated database retrieval system